EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04716 - ETC_C1_NDUFA5)
FAM  PF04716
PID  ETC_C1_NDUFA5
DES  ETC complex I subunit conserved region
IPR  IPR006806
ANO  5
ALN  58
AID  0.387608
APH  ((O94061_CANAL/37-94:0.39462,NUFM_ARATH/27-83:0.69411):0.34784,(NUFM_CAEEL/52-108:0.22565,Q9VTB4_DROME/18-74:0.58916):0.26292,NUFM_MOUSE/17-73:0.55664);
ATP  ((O94061_CANAL/37-94,NUFM_ARATH/27-83),(NUFM_CAEEL/52-108,Q9VTB4_DROME/18-74),NUFM_MOUSE/17-73);
ATL  3.07096
DNO  5
DLN  174
DID  0.461988
DPH  (O94061_CANAL/37-94:0.36582,((Q9VTB4_DROME/18-74:0.46031,NUFM_CAEEL/52-108:0.21254):0.22865,NUFM_MOUSE/17-73:0.51610):0.15156,NUFM_ARATH/27-83:0.52182);
DTP  (O94061_CANAL/37-94,((Q9VTB4_DROME/18-74,NUFM_CAEEL/52-108),NUFM_MOUSE/17-73),NUFM_ARATH/27-83);
DTL  2.4568
RID  0.387608
RPH  ((O94061_CANAL/37-94:0.39462,NUFM_ARATH/27-83:0.69411):0.34784,(NUFM_CAEEL/52-108:0.22565,Q9VTB4_DROME/18-74:0.58916):0.26292,NUFM_MOUSE/17-73:0.55664);
RTP  ((O94061_CANAL/37-94,NUFM_ARATH/27-83),(NUFM_CAEEL/52-108,Q9VTB4_DROME/18-74),NUFM_MOUSE/17-73);
RTL  3.07096
LNK  NUFM_ARATH/27-83:Q9FLX7:AB009055
LNK  NUFM_CAEEL/52-108:Q18359:Z68493
LNK  NUFM_MOUSE/17-73:Q9CPP6:AK008156
LNK  O94061_CANAL/37-94:O94061:AL033503
LNK  Q9VTB4_DROME/18-74:Q9VTB4:AE003547
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NUFM_ARATH/27-83
ASQ  PNARAVLIDLYSKTLKEIQ-AVPEDEGYRKAVESFTRQRLNVCKEEEDWEMIEKRLGC
DSQ  CCCAACGCGAGAGCGGTGCTGATCGATCTCTACAGCAAAACCCTAAAGGAGATCCAA---GCTGTGCCGGAGGATGAAGGGTACCGTAAAGCGGTGGAATCATTCACGCGCCAACGTCTCAATGTGTGCAAGGAAGAAGAAGATTGGGAGATGATTGAGAAGCGGCTTGGTTGT
TRN  10010101100011001
NAM  O94061_CANAL/37-94
ASQ  PNPRPALVTLYNETLKTLKENFPADSVYRQSTEALTQNRLKIVESEEIVENIENQIGG
DSQ  CCAAATCCAAGACCTGCTTTGGTTACTTTATACAATGAAACTTTGAAAACATTAAAAGAAAACTTCCCTGCAGATTCAGTTTATAGACAATCTACAGAAGCTTTAACTCAAAATAGATTGAAGATTGTTGAAAGTGAAGAGATAGTCGAGAACATAGAGAACCAAATTGGTGGT
TRN  10010101110011000
NAM  Q9VTB4_DROME/18-74
ASQ  TNPHHTLSALYGKILRAVS-KMPQDASYRKYTEQLVKQRADSVAQHKDITALEKAVGC
DSQ  ACCAATCCACACCACACGCTGAGTGCTCTGTATGGCAAGATTCTGCGGGCGGTGTCC---AAGATGCCACAGGACGCCAGCTACCGCAAGTACACGGAGCAACTGGTCAAGCAGCGCGCCGATTCTGTGGCCCAACACAAGGACATCACTGCCCTGGAAAAGGCCGTCGGTTGC
TRN  11011111101111111
NAM  NUFM_CAEEL/52-108
ASQ  EHPHRALTVVYGRILRALE-QIPRDAAYRKYTEAVVKQRLALVQAENDIKKLEEKIGM
DSQ  GAGCATCCACATCGTGCGTTGACTGTTGTGTATGGCAGAATTCTCCGCGCCCTTGAA---CAAATTCCACGGGATGCTGCTTACCGCAAGTATACTGAAGCTGTGGTAAAGCAGCGTTTGGCTCTTGTTCAAGCCGAAAACGACATTAAGAAGCTTGAGGAGAAAATTGGAATG
TRN  10010101110011011
NAM  NUFM_MOUSE/17-73
ASQ  DTPHERLTILYTKTLDILK-HFPKHAAYRKYTEQITNEKLDMVKAEPDVKKLEALLQG
DSQ  GACACTCCACACGAGAGGCTCACAATATTGTATACAAAGACTCTTGATATTCTGAAG---CACTTTCCTAAACATGCAGCCTATAGAAAATACACAGAACAGATCACCAACGAGAAGCTGGATATGGTCAAGGCGGAGCCAGATGTTAAAAAATTAGAAGCCTTGCTTCAGGGT
TRN  10010101100011010
//