EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04695 - Pex14_N)
FAM  PF04695
PID  Pex14_N
DES  Peroxisomal membrane anchor protein (Pex14p) conserved region
IPR  IPR006785
ANO  10
ALN  153
AID  0.317289
APH  ((((((Q9FW35_ORYSA/91-151:0.71402,(Q9NE79_LEIMA/204-356:1.10784,Q93930_CAEEL/9-116:1.12548):0.27111):0.11375,(Q9VPB8_DROME/33-145:0.97558,PEX14_HUMAN/24-135:0.41153):0.40734):0.26569,Q9P5M0_NEUCR/3-129:0.48413):0.10380,O60065_SCHPO/1-98:0.65126):0.18756,PEX14_YEAST/8-123:0.76813):0.10943,PEX14_PICAN/9-120:0.18137,Q9HG09_PICPA/4-126:0.34071);
ATP  ((((((Q9FW35_ORYSA/91-151,(Q9NE79_LEIMA/204-356,Q93930_CAEEL/9-116)),(Q9VPB8_DROME/33-145,PEX14_HUMAN/24-135)),Q9P5M0_NEUCR/3-129),O60065_SCHPO/1-98),PEX14_YEAST/8-123),PEX14_PICAN/9-120,Q9HG09_PICPA/4-126);
ATL  8.2966
DNO  9
DLN  459
DID  0.421411
DPH  ((((Q9HG09_PICPA/4-126:0.24227,(PEX14_YEAST/8-123:0.42970,O60065_SCHPO/1-98:0.47505):0.17916):0.12301,PEX14_PICAN/9-120:0.22593):0.13371,((Q9P5M0_NEUCR/3-129:0.36642,Q9NE79_LEIMA/204-356:0.75783):0.10451,Q93930_CAEEL/9-116:0.87519):0.08938):0.28371,Q9VPB8_DROME/33-145:0.58254,PEX14_HUMAN/24-135:0.38283);
DTP  ((((Q9HG09_PICPA/4-126,(PEX14_YEAST/8-123,O60065_SCHPO/1-98)),PEX14_PICAN/9-120),((Q9P5M0_NEUCR/3-129,Q9NE79_LEIMA/204-356),Q93930_CAEEL/9-116)),Q9VPB8_DROME/33-145,PEX14_HUMAN/24-135);
DTL  5.25124
RID  0.309803
RPH  (((Q9VPB8_DROME/33-145:0.98679,PEX14_HUMAN/24-135:0.40011):0.59469,O60065_SCHPO/1-98:0.63274):0.03524,((PEX14_PICAN/9-120:0.16849,Q9HG09_PICPA/4-126:0.35435):0.13146,PEX14_YEAST/8-123:0.75345):0.15268,(Q9P5M0_NEUCR/3-129:0.37499,(Q9NE79_LEIMA/204-356:1.03459,Q93930_CAEEL/9-116:1.21976):0.43246):0.25965);
RTP  (((Q9VPB8_DROME/33-145,PEX14_HUMAN/24-135),O60065_SCHPO/1-98),((PEX14_PICAN/9-120,Q9HG09_PICPA/4-126),PEX14_YEAST/8-123),(Q9P5M0_NEUCR/3-129,(Q9NE79_LEIMA/204-356,Q93930_CAEEL/9-116)));
RTL  7.53145
LNK  O60065_SCHPO/1-98:O60065:AL022600
LNK  PEX14_HUMAN/24-135:O75381:AF045186
LNK  PEX14_PICAN/9-120:P78723:U46195
LNK  PEX14_YEAST/8-123:P53112:Z72675
LNK  Q93930_CAEEL/9-116:Q93930:Z81107
LNK  Q9FW35_ORYSA/91-151:Q9FW35:
LNK  Q9HG09_PICPA/4-126:Q9HG09:AF200421
LNK  Q9NE79_LEIMA/204-356:Q9NE79:AL163505
LNK  Q9P5M0_NEUCR/3-129:Q9P5M0:AL356172
LNK  Q9VPB8_DROME/33-145:Q9VPB8:AE003592
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O60065_SCHPO/1-98
ASQ  MREDLLRNSVEFLREKTVLDAPDVKKIEFLKSKGLTAEEIQEAFKLAKN-----------------------------------------------------PLFPSYPRFENTSNFVSR--DWRDWFIMGVISTGFAWSAYSLVKKYIAPMF
DSQ  ATGAGGGAGGATTTGTTAAGAAACTCCGTTGAATTTTTAAGAGAAAAAACTGTATTAGATGCTCCTGATGTGAAAAAGATTGAATTTCTAAAATCCAAAGGTTTAACTGCCGAAGAAATTCAAGAAGCATTCAAGCTAGCAAAAAAT---------------------------------------------------------------------------------------------------------------------------------------------------------------CCGCTATTCCCTTCTTATCCTCGATTTGAAAACACTAGTAATTTTGTTTCAAGA------GATTGGAGAGATTGGTTTATTATGGGCGTTATTTCGACTGGATTTGCATGGTCGGCGTATTCATTAGTAAAGAAATACATAGCACCAATGTTT
TRN  10010101110011000
NAM  PEX14_YEAST/8-123
ASQ  DRKALFDSAVSFLKDESIKDAPLLKKIEFLKSKGLTEKEIEIAMKEPKKD-----------------------------------GIVGDEVSKKIGSTENRASQDMYLYEAMPPTLPHR--DWKDYFVMATATAGLLYGAYEVTRRYVIPNI
DSQ  GATCGTAAGGCATTGTTCGACTCAGCAGTATCCTTTTTAAAGGATGAGTCCATTAAAGATGCTCCACTTTTAAAGAAAATCGAATTTTTAAAATCCAAAGGGTTAACAGAAAAGGAGATTGAAATAGCCATGAAAGAGCCCAAGAAAGAC---------------------------------------------------------------------------------------------------------GGTATCGTAGGCGATGAAGTATCGAAAAAAATTGGTAGTACTGAGAATAGAGCCTCACAGGATATGTATCTCTATGAAGCGATGCCACCAACGCTGCCCCACAGG------GATTGGAAGGACTATTTTGTGATGGCTACTGCCACAGCTGGGCTGTTGTATGGTGCATATGAAGTAACTAGAAGGTATGTGATACCAAATATT
TRN  10010101100011000
NAM  Q9HG09_PICPA/4-126
ASQ  IREEMVTSAVEFLKNPQIADSPLAKKIEFIESKGLNEAEVKEALLRSQGG-----------------------NGSSSVASQVSSYSPSASQSSVAPSPPPFPDHYRNAPP-----LPER--DWKDYFVMATATAGVSFGLYKVISNYVLPKL
DSQ  ATACGTGAAGAAATGGTGACTTCGGCAGTGGAGTTTCTAAAGAACCCACAGATTGCCGATTCGCCTCTTGCAAAAAAGATCGAATTCATTGAAAGCAAAGGCTTGAATGAAGCCGAGGTTAAGGAGGCATTGCTGAGATCACAGGGTGGT---------------------------------------------------------------------AATGGTTCGTCCTCAGTTGCCTCCCAAGTGTCATCGTATTCTCCCTCAGCATCTCAGTCTAGTGTAGCGCCATCTCCTCCTCCTTTTCCTGATCATTATAGAAATGCCCCGCCA---------------TTGCCCGAAAGA------GACTGGAAAGATTATTTTGTAATGGCTACAGCTACTGCCGGTGTTTCGTTTGGGCTTTATAAAGTCATCAGCAACTACGTTTTACCAAAACTT
TRN  10010101100011000
NAM  PEX14_PICAN/9-120
ASQ  SRAELVSSAVEFLLDQSIADSPLAKKVEFLESKGLTQQEIEEALQKARTG----------------------------------TVQASPSQQSVVPPRPPVPDYYPSAPP-----LPER--DWKDYFIMATATAGISYGVYQFVKRYVVPKI
DSQ  AGCCGTGCAGAGCTGGTATCCAGCGCAGTTGAGTTTCTTTTGGACCAGAGCATTGCGGACTCGCCGCTCGCCAAAAAGGTCGAATTTCTAGAATCTAAAGGCCTTACCCAGCAGGAAATCGAGGAGGCGTTACAAAAGGCTCGTACGGGC------------------------------------------------------------------------------------------------------ACAGTTCAGGCATCGCCATCACAGCAGTCCGTTGTACCGCCTCGCCCACCAGTGCCCGATTATTACCCTAGCGCACCTCCA---------------CTGCCTGAGCGT------GATTGGAAGGACTACTTTATCATGGCAACAGCAACGGCAGGAATTTCGTATGGGGTGTACCAGTTTGTGAAACGGTACGTTGTTCCGAAAATT
TRN  11011101101011000
NAM  Q9P5M0_NEUCR/3-129
ASQ  IREDLVASAAQFLQDPSVAASPIEKRIAFLQAKNLTQEEVSAALARAESG------------------------GPPPPYAQSPAYAQSAGPVAAQGGSPQYYGYPPYAWPQSNTDGVRR--DWRDLFILATVVGGASYGLYNLGKRYVYPLI
DSQ  ATCCGCGAGGACCTGGTCGCTTCGGCGGCGCAGTTTCTTCAAGACCCCAGTGTCGCCGCCTCGCCAATCGAGAAGCGGATAGCCTTTCTCCAAGCAAAGAACCTCACCCAGGAAGAAGTCAGCGCTGCTCTCGCCCGCGCCGAATCAGGA------------------------------------------------------------------------GGTCCACCGCCACCGTACGCCCAGTCGCCCGCCTATGCGCAGTCGGCCGGACCCGTCGCAGCACAGGGTGGCTCTCCGCAGTACTATGGCTATCCCCCATACGCATGGCCGCAATCGAATACCGACGGTGTCAGGCGG------GACTGGAGGGACCTGTTCATTTTGGCGACCGTAGTCGGAGGCGCGTCGTACGGCCTATACAATCTCGGCAAGCGCTATGTGTATCCTTTGATT
TRN  10010101100011001
NAM  PEX14_HUMAN/24-135
ASQ  PREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTA---------------------------------------ADEPSSLGPATQVVPVQPPHLISQPYSPAGS--RWRDYGALAIIMAGIAFGFHQLYKKYLLPLI
DSQ  CCTCGAGAGCCGCTGATTGCCACGGCAGTGAAGTTTCTACAGAATTCCCGGGTCCGCCAGAGCCCACTTGCAACCAGGAGAGCATTTCTAAAGAAGAAAGGGCTGACAGATGAAGAGATTGATATGGCCTTCCAGCAGTCGGGCACTGCT---------------------------------------------------------------------------------------------------------------------GCCGATGAGCCTTCGTCCTTGGGCCCAGCCACACAGGTGGTTCCTGTCCAGCCCCCTCACCTCATATCTCAGCCATACAGTCCCGCAGGCTCC------CGATGGCGAGATTACGGCGCCCTGGCCATCATCATGGCAGGCATTGCATTTGGCTTTCACCAGCTCTACAAGAAATACCTGCTCCCCCTCATC
TRN  10010101100011011
NAM  Q9FW35_ORYSA/91-151
ASQ  VREDYVQNAVKFLSHPKVRGSPVLYRRSFLEKKGLTKDEIDEAFRRVPR--------------------------------------------------------------------------------------------YCYCCCFPFAFT
NAM  Q9VPB8_DROME/33-145
ASQ  PRESLITTAVSFLQNTKVRHTTLIQKQQFLRSKGLTAHEIQLACERAGVF--------------------------------------TQDPNKPNPNPNTVISIGSQLHALQPQPTVLG--RIREIIHSAALFSGVVYAVYIFWKQYIAPYL
DSQ  CCTCGAGAATCGCTGATAACCACTGCAGTCAGTTTTCTACAAAACACCAAGGTGCGCCACACGACACTTATCCAGAAGCAGCAGTTCCTACGGTCCAAAGGTCTCACCGCTCACGAAATTCAGCTGGCCTGTGAACGGGCCGGCGTTTTC------------------------------------------------------------------------------------------------------------------ACCCAAGACCCCAACAAGCCCAATCCGAATCCGAACACCGTCATTAGCATTGGATCCCAATTGCACGCGCTGCAGCCGCAGCCGACTGTCTTGGGC------CGGATCAGGGAAATCATCCATTCGGCAGCCCTGTTCAGCGGAGTCGTCTACGCAGTCTACATCTTCTGGAAGCAATACATTGCGCCCTACCTG
TRN  10010101100011011
NAM  Q9NE79_LEIMA/204-356
ASQ  DADTTVQSAIRFLQDPRVRCSPVESQIRFLKGKGVSDGQIKYALAKVGRTVTAEKIASVRAPLANAAPTGATATAYATPLSAQLKTARQNAPVAMTPGPQYTQMLFPHSPPPPQVERQTKTVDWRDVVIGAGAAMLAGFSAYKLFNRYSPYEF
DSQ  GATGCTGATACAACGGTTCAGTCCGCCATCCGCTTCTTGCAAGATCCACGCGTGCGGTGCTCGCCGGTCGAGTCGCAGATCCGTTTCCTCAAGGGTAAAGGCGTATCAGATGGACAGATAAAGTACGCCCTCGCCAAGGTAGGAAGGACAGTCACAGCGGAGAAGATTGCCTCTGTTCGTGCCCCGCTCGCCAACGCAGCACCGACCGGTGCCACAGCGACGGCGTATGCCACCCCTCTTTCTGCACAGCTCAAGACGGCGCGGCAAAACGCGCCAGTGGCCATGACGCCAGGCCCGCAGTACACGCAAATGCTGTTTCCTCACTCGCCCCCACCACCGCAGGTGGAGCGACAGACGAAGACAGTGGACTGGCGCGACGTCGTGATTGGCGCCGGCGCCGCCATGCTTGCTGGGTTTTCTGCGTACAAACTCTTCAACCGGTACTCCCCTTACGAATTT
TRN  10010101100011001
NAM  Q93930_CAEEL/9-116
ASQ  IRPDMVEAARKFMLTPKVKETPFEEQRQFLLGKGVSEAEILEARASIPPE---------------------------------------------QLRSQIGTENMIPIGGHPQMMIAPKQNGIVSFAQSAVVLGSISYAGYRFVRSYVLPRF
DSQ  ATTCGACCGGACATGGTAGAAGCAGCAAGAAAGTTTATGCTAACTCCAAAAGTTAAAGAGACTCCATTTGAAGAACAACGACAGTTTTTATTAGGAAAAGGAGTCAGTGAGGCTGAAATCTTGGAAGCACGAGCATCTATTCCGCCGGAG---------------------------------------------------------------------------------------------------------------------------------------CAGTTGAGAAGTCAAATTGGAACAGAGAATATGATTCCAATAGGAGGTCATCCGCAAATGATGATTGCTCCAAAACAGAATGGAATAGTATCATTTGCACAATCAGCTGTGGTACTTGGATCGATTTCATATGCTGGATATCGATTCGTCCGATCATATGTTCTGCCCAGATTC
TRN  10010101100011000
//