EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04664 - OGFr_N)
FAM  PF04664
PID  OGFr_N
DES  Opioid growth factor receptor (OGFr) conserved region
IPR  IPR006757
ANO  2
ALN  215
AID  0.820896
APH  (OGFR_MOUSE/71-285:0.05846,OGFR_HUMAN/81-295:0.12987);
ATP  (OGFR_MOUSE/71-285,OGFR_HUMAN/81-295);
ATL  0.18832
DNO  2
DLN  645
DID  0.837209
DPH  (OGFR_MOUSE/71-285:0.04537,OGFR_HUMAN/81-295:0.14069);
DTP  (OGFR_MOUSE/71-285,OGFR_HUMAN/81-295);
DTL  0.18607
RID  0.820896
RPH  (OGFR_MOUSE/71-285:0.05846,OGFR_HUMAN/81-295:0.12987);
RTP  (OGFR_MOUSE/71-285,OGFR_HUMAN/81-295);
RTL  0.18833
LNK  OGFR_HUMAN/81-295:Q9NZT2:BC014137
LNK  OGFR_MOUSE/71-285:Q99PG2:AF303894
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  OGFR_MOUSE/71-285
ASQ  DLTDQDCNGDMCNLSFYKNEICFQPNGFLIEDILQNWKDNYDLLEENHSYIQWLFPLREPGVNWHAKPLTLKEVEAFKSSKEVRERLVRAYELMLGFYGIQLEDRNTGAVCRAQNFQPRFHNLNSHSHNNLRITRILKSLGELGLEHYQAPLVRFFLEETLVQHKLPSVRQSALDYFLFAVRCRHQRRELVHFAWEHFKPRREFVWGPRDKLRRF
DSQ  GATTTGACAGATCAAGACTGCAACGGAGACATGTGCAACCTGAGCTTCTACAAAAATGAGATCTGCTTCCAGCCAAATGGCTTTCTCATTGAGGACATTCTTCAGAACTGGAAAGACAACTATGACCTCCTGGAAGAGAATCACTCCTACATCCAGTGGCTGTTTCCCCTGAGGGAACCAGGAGTGAACTGGCATGCCAAGCCCCTCACACTGAAGGAGGTTGAGGCATTTAAAAGCTCCAAGGAAGTCAGAGAGCGTCTTGTCCGGGCCTATGAGCTCATGCTGGGCTTCTATGGGATCCAACTTGAGGACCGGAACACAGGCGCCGTATGCCGTGCACAGAACTTCCAGCCACGCTTCCACAATCTCAACAGCCACAGCCACAACAATCTGCGTATTACACGCATCCTCAAGTCGCTGGGCGAGCTGGGCTTAGAGCACTACCAGGCACCGCTGGTGCGCTTCTTCCTGGAGGAGACCCTAGTACAGCACAAACTGCCCAGCGTTCGCCAGAGTGCCCTGGACTACTTCCTGTTTGCCGTGCGCTGCCGGCACCAGCGCCGGGAGCTCGTGCACTTTGCTTGGGAGCACTTCAAGCCTCGCCGAGAGTTTGTCTGGGGGCCCCGTGACAAGCTGCGGAGGTTC
TRN  10010101100011010
NAM  OGFR_HUMAN/81-295
ASQ  DLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREPGVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNNLRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRPRCKFVWGPQDKLRRF
DSQ  GATCTGGTGGAACGAGACTGCAATGGGGACACGCCAAACCTGAGTTTCTACAGAAATGAGATCCGCTTCCTGCCCAACGGCTGTTTCATTGAGGACATTCTTCAGAACTGGACGGACAACTATGACCTCCTTGAGGACAATCACTCCTACATCCAGTGGCTGTTTCCTCTGCGAGAACCAGGAGTGAACTGGCATGCCAAGCCCCTCACGCTCAGGGAGGTCGAGGTGTTTAAAAGCTCCCAGGAGATCCAGGAGCGGCTTGTCCGGGCCTACGAGCTCATGCTGGGCTTCTACGGGATCCGGCTGGAGGACCGAGGCACGGGCACGGTGGGCCGAGCACAGAACTACCAGAAGCGCTTCCAGAACCTGAACTGGCGCAGCCACAACAACCTCCGCATCACACGCATCCTCAAGTCGCTGGGTGAGCTGGGCCTCGAGCACTTCCAGGCGCCGCTGGTCCGCTTCTTCCTGGAGGAGACGCTGGTGCGGCGGGAGCTGCCGGGGGTGCGGCAGAGTGCCCTGGACTACTTCATGTTCGCCGTGCGCTGCCGACACCAGCGCCGCCAGCTGGTGCACTTCGCCTGGGAGCACTTCCGGCCCCGCTGCAAGTTCGTCTGGGGGCCCCAAGACAAGCTGCGGAGGTTC
TRN  10010101100011011
//