EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04660 - Nanovirus_coat)
FAM  PF04660
PID  Nanovirus_coat
DES  Nanovirus coat protein
IPR  IPR006753
ANO  3
ALN  175
AID  0.36178
APH  (Q9QJK9_9VIRU/1-170:1.61756,COAT_MDV1/2-172:0.28771,COAT_SCSVF/3-169:0.31765);
ATP  (Q9QJK9_9VIRU/1-170,COAT_MDV1/2-172,COAT_SCSVF/3-169);
ATL  2.22292
DNO  3
DLN  525
DID  0.465463
DPH  (Q9QJK9_9VIRU/1-170:1.08251,COAT_MDV1/2-172:0.32979,COAT_SCSVF/3-169:0.22219);
DTP  (Q9QJK9_9VIRU/1-170,COAT_MDV1/2-172,COAT_SCSVF/3-169);
DTL  1.63449
RID  0.36178
RPH  (Q9QJK9_9VIRU/1-170:1.61756,COAT_MDV1/2-172:0.28771,COAT_SCSVF/3-169:0.31765);
RTP  (Q9QJK9_9VIRU/1-170,COAT_MDV1/2-172,COAT_SCSVF/3-169);
RTL  2.22292
LNK  COAT_MDV1/2-172:Q9Z035:AB009046
LNK  COAT_SCSVF/3-169:Q87012:U16734
LNK  Q9QJK9_9VIRU/1-170:Q9QJK9:AF148945
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9QJK9_9VIRU/1-170
ASQ  MARFPRKSIKKRRVGRRKYGSKA-----ATSHDYSSLGSILVPENTVKVFRIEPTDKTLPRYFIWKMFMLLVCKVKPGRILHWAMIKSSWEINQPNTCLEASGLFIKPEHSHLVKLVCSGELEAGVATGTSDVECLLRKTTVLRKNVTEVDYLYLAFYCSAGVSINYQNRITYHV
DSQ  ATGGCGAGGTTTCCGAGGAAATCGATCAAGAAGAGGCGGGTTGGGCGACGGAAGTATGGAAGCAAGGCG---------------GCAACCAGTCACGACTACTCGTCGTTAGGTTCAATATTGGTTCCTGAAAACACCGTCAAGGTATTTCGGATTGAGCCTACTGATAAAACATTACCCAGATATTTTATCTGGAAAATGTTTATGCTTTTGGTGTGCAAGGTGAAGCCCGGAAGAATACTTCACTGGGCTATGATTAAAAGTTCATGGGAAATCAACCAGCCGAATACATGTCTGGAAGCATCAGGTTTATTTATAAAACCTGAACATAGCCATCTGGTGAAACTGGTATGCAGTGGGGAACTTGAAGCCGGAGTCGCAACAGGGACATCAGATGTTGAATGTCTTCTAAGGAAGACAACCGTGTTGAGGAAGAATGTAACAGAGGTGGATTACTTGTATTTGGCATTTTATTGTAGTGCTGGAGTTAGTATTAACTACCAGAACAGAATTACATATCATGTA
TRN  10010101100011000
NAM  COAT_MDV1/2-172
ASQ  VSNWNWNGMKRRRTPRRGYGR-PYKPVVPITRVVVHQSALLKKDEVVGC-EIKP-DGDVARYKMMKVMLTCTLRMPPGELVNYIIVKSSSPIANWSAAFTTPALLVKESCQDMISIIAKGKVESNGVAG-TDCTKSFNKFIRLGAGISQTQHLYVVMYTSVALKLVLEHRVYIEL
DSQ  GTGAGCAATTGGAATTGGAATGGGATGAAGAGACGACGAACTCCTCGTCGTGGTTACGGCAGG---CCTTACAAGCCTGTTGTTCCTATAACCAGGGTCGTCGTCCATCAATCAGCTCTGCTGAAGAAAGATGAAGTTGTTGGGTGT---GAGATAAAACCA---GATGGTGATGTTGCTCGTTATAAGATGATGAAGGTTATGTTAACCTGTACTTTGAGGATGCCTCCTGGAGAATTAGTCAATTATATCATCGTTAAGAGCAGTTCTCCCATTGCTAATTGGTCTGCAGCTTTTACTACTCCTGCTCTGTTAGTGAAGGAAAGTTGTCAAGACATGATATCCATTATTGCTAAGGGCAAGGTTGAGTCTAACGGAGTTGCAGGT---ACTGACTGTACAAAGTCATTTAATAAATTTATTAGATTGGGAGCCGGTATCAGCCAAACCCAGCATTTGTATGTTGTTATGTACACTAGTGTTGCTTTGAAGCTTGTGTTAGAACATAGAGTGTATATTGAACTG
TRN  10010101100011000
NAM  COAT_SCSVF/3-169
ASQ  AVRW---GRKGLRSQRRKYSRIAYKP--PSSKVVSHVESVLNKRDVTGA-EVKP-FADGSRYSMKKVMLIATLTMAPGELVNYLIVKSNSPIANWSSSFSNPSLMVKESVQDTVTIVGGGKLESSGTAG-KDVTKSFRKFVKLGSGISQTQHLYLIIYSSDAMKITLETRMYIDV
DSQ  GCTGTTCGATGG---------GGAAGAAAGGGTCTGAGGTCTCAAAGGAGAAAATATTCGCGAATTGCTTACAAACCT------CCTTCGTCTAAGGTTGTAAGTCATGTGGAGTCTGTTCTGAATAAGAGAGATGTTACTGGAGCG---GAGGTTAAGCCA---TTCGCTGATGGTTCAAGGTATAGTATGAAGAAGGTAATGTTGATTGCAACATTAACTATGGCTCCTGGAGAATTAGTTAATTATCTTATTGTGAAGAGTAATTCGCCTATTGCGAATTGGAGTTCGTCTTTCAGTAATCCTTCGTTGATGGTGAAAGAGTCTGTTCAAGATACAGTTACGATTGTTGGAGGAGGAAAGCTTGAGTCTTCTGGTACTGCTGGT---AAAGATGTAACTAAGTCTTTTAGGAAGTTTGTTAAGCTGGGTTCAGGTATTAGTCAGACCCAGCATTTGTATTTAATTATTTATTCCAGTGATGCGATGAAGATCACACTGGAGACGAGAATGTATATTGATGTA
TRN  10010101100011000
//