EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04656 - Pox_E6)
FAM  PF04656
PID  Pox_E6
DES  Pox virus E6 protein
IPR  IPR006749
ANO  5
ALN  571
AID  0.57014
APH  (VE06_VARV/1-567:0.22559,(Q9DHS5_YLDV/1-567:0.23335,Q9Q8R4_9POXV/1-565:0.25406):0.10369,(V096_FOWPV/1-571:0.48344,Q98205_MCV1/1-565:0.31778):0.13387);
ATP  (VE06_VARV/1-567,(Q9DHS5_YLDV/1-567,Q9Q8R4_9POXV/1-565),(V096_FOWPV/1-571,Q98205_MCV1/1-565));
ATL  1.75178
DNO  5
DLN  1713
DID  0.579633
DPH  (VE06_VARV/1-567:8.39248,(Q98205_MCV1/1-565:16.62401,Q9Q8R4_9POXV/1-565:7.74566):2.45538,(V096_FOWPV/1-571:17.03465,Q9DHS5_YLDV/1-567:7.96143):1.80464);
DTP  (VE06_VARV/1-567,(Q98205_MCV1/1-565,Q9Q8R4_9POXV/1-565),(V096_FOWPV/1-571,Q9DHS5_YLDV/1-567));
DTL  61.802
RID  0.57014
RPH  (VE06_VARV/1-567:0.22559,(Q9DHS5_YLDV/1-567:0.23335,Q9Q8R4_9POXV/1-565:0.25406):0.10369,(V096_FOWPV/1-571:0.48344,Q98205_MCV1/1-565:0.31778):0.13387);
RTP  (VE06_VARV/1-567,(Q9DHS5_YLDV/1-567,Q9Q8R4_9POXV/1-565),(V096_FOWPV/1-571,Q98205_MCV1/1-565));
RTL  1.75178
LNK  Q98205_MCV1/1-565:Q98205:U60315
LNK  Q9DHS5_YLDV/1-567:Q9DHS5:AJ293568
LNK  Q9Q8R4_9POXV/1-565:Q9Q8R4:AF170726
LNK  V096_FOWPV/1-571:Q9J5C4:AF198100
LNK  VE06_VARV/1-567:P33819:X69198
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VE06_VARV/1-567
ASQ  MDFIRRKYLIYTVENNIDFLKDDTLSKVNNFTLNHVLALKYLVSNFPQHVITKDVLANTNFFVFIHMVRCCKVYEAVLRHAFDAPTLYVKALTKNYLSFSNAIQSYKETVHKLTQDEKFLEVAEYMEELGELIGVNYDLVLNPLFHGGEPIKDMEIIFLKLFKKTDFKVVKKLSVIRLLIWAYLSKKDTGIEFADNDRQDIYTLFQHTGRIVHSNLTETFRDYIFPG-DKTSYWVWLNESIANDADIVLNRPAITMYDKILSYIYSEIKQGRVNKNMLKLVYIFEPEKDIRELLLEIIYDIPGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDRTFNEDLFRVVVQIDPEYFDNER-IMSLFSTSAVEIKRFDELDINNSYISNIIYEVNDITLDTMDDMKKCQIFNEDTSYYVKEYNTYLFLNETDPMVIENGILKKLSSIKSK--SRRLNLFSKNILKYYLDGQLARLGLVLDDYKGDLLVKMINHLKFVEDVSAFVRFSTDKNPSVLPSLINTILASYNISIIVLFQKFLRDNLYHVEKFLDKSIHLTKTDKKYILQLIRHGRS
DSQ  ATGGATTTTATTCGTAGAAAGTATCTTATATACACAGTAGAAAATAATATAGATTTTTTAAAGGATGATACATTAAGTAAAGTAAACAATTTTACCCTCAATCATGTACTAGCTCTCAAGTATCTAGTTAGCAATTTTCCTCAACACGTTATTACTAAGGATGTATTAGCTAATACCAATTTTTTTGTTTTCATACATATGGTACGATGTTGTAAAGTGTACGAAGCGGTTTTACGACACGCATTTGATGCACCCACGTTGTACGTTAAAGCATTGACTAAGAATTATTTATCGTTTAGTAACGCAATACAATCGTACAAGGAAACAGTGCATAAACTAACACAAGATGAAAAATTTTTAGAGGTAGCCGAATACATGGAAGAATTAGGAGAACTTATAGGGGTAAATTATGACTTAGTTCTTAATCCATTATTTCACGGAGGGGAACCCATCAAAGATATGGAAATCATTTTTTTAAAACTGTTTAAGAAAACAGACTTTAAAGTTGTTAAAAAATTAAGTGTTATAAGATTACTTATTTGGGCTTACCTAAGCAAGAAAGATACAGGTATAGAGTTTGCGGATAATGATAGACAAGATATATATACTCTATTTCAACACACTGGTAGAATAGTCCATAGCAATCTAACAGAAACGTTTAGAGATTATATCTTTCCCGGA---GATAAGACTAGCTATTGGGTGTGGTTAAACGAAAGTATAGCTAATGATGCAGATATCGTTCTTAATAGACCCGCCATTACCATGTATGATAAAATTCTTAGTTATATATACTCTGAGATAAAACAGGGACGTGTTAATAAAAACATGCTTAAGTTAGTTTATATCTTTGAGCCTGAAAAAGATATCAGAGAACTTCTGCTAGAAATCATATATGATATTCCTGGAGATATCCTATCTATTATTGATGCAAAAAACGACGATTGGAAAAAATATTTTATTAGTTTTTACAAAGCTAATTTTATTAACGGTAATACATTTATTAGCGATAGAACGTTTAACGAGGATTTATTCAGAGTTGTTGTTCAAATAGATCCTGAATATTTTGATAATGAACGA---ATTATGTCTTTATTCTCTACGAGTGCTGTGGAAATTAAACGATTTGATGAGTTAGATATTAATAACAGTTATATATCTAATATAATTTATGAGGTGAACGATATCACATTAGATACAATGGATGATATGAAGAAGTGCCAAATCTTTAACGAGGATACATCGTATTATGTTAAGGAATACAATACATACCTGTTTTTGAACGAGACGGATCCCATGGTCATAGAGAACGGAATACTAAAGAAACTGTCATCTATAAAATCCAAG------AGTAGACGACTGAACTTGTTTAGCAAAAACATTTTAAAATATTATTTAGACGGACAATTGGCTCGTCTAGGTCTTGTGTTAGATGATTATAAAGGAGACTTGTTAGTTAAAATGATAAACCATCTCAAGTTTGTGGAGGATGTATCAGCATTCGTTAGATTTTCTACAGATAAAAACCCTAGTGTTCTTCCATCGCTAATCAACACTATTTTAGCTAGTTATAATATTTCCATCATTGTCCTATTTCAAAAGTTTTTAAGAGATAATCTATATCATGTAGAAAAATTCTTGGATAAAAGCATCCATCTAACCAAGACGGATAAGAAATATATACTTCAATTGATAAGGCACGGCAGATCA
TRN  10010101100011000
NAM  Q9Q8R4_9POXV/1-565
ASQ  MDFIRRKYLIYTIDNRIDFLRDEMISKVSNFNLNNVLAIKYLVINFCKDVVSKDVLTNPNFFVFLHIVKCKDVYNELLCCVFDAPTLYIKALVKHYALFSDVIETYKKTVQELMFDDRFTEVARHATRFGDIIGVNYDLALNPLFHYGEPIKNMDIVYGKLFKKSDFKRVKKMEVFRLMIWAYLSKQDTGIEFSDNDSQDIYTLFQTSDNVIHSDMTEKFKEYIFGG-NRSSRWIWLNEPIANDADIYLDGFAVSMYDKVLSYVYSELKQGRVNKNMLKLVYIFETDEYIQSVLLQIIYDVPGDILSIIEAKDDAWKKYFIGLYKEHFIDGKTFNSTRTFNSDLFNVVAKISPSYFDPEK-VISAFDHPPDKVKFFDKMDINDTYISNIVYETKELNISTIEESQKCQIYNQETSYYIKEYNTYMYLHEEDPYVLHKGMFVKLSTVPQ---DKKFSLFSDHILKYYIDGKLARIGLVVTDYK-DVLVDILSHLKCVEDVTTFVRFSVCKNSSVISSVVRTILGNFNTSVIVLFQKFLRDNMYYVELFLDNTNHLTENDKKYLLNVIKHGRT
DSQ  ATGGATTTTATTAGACGCAAGTACTTAATTTATACCATAGATAATAGGATTGATTTTTTACGTGATGAAATGATATCTAAAGTGTCTAATTTTAACCTCAATAACGTGTTAGCTATTAAGTATTTAGTTATTAACTTTTGTAAGGACGTAGTTAGTAAGGATGTATTAACAAACCCCAACTTTTTTGTTTTTCTTCATATCGTTAAGTGCAAGGATGTATATAACGAGCTGCTTTGTTGCGTATTCGACGCACCCACGCTGTATATAAAAGCGCTAGTCAAACACTACGCGTTATTTAGTGACGTAATAGAAACGTATAAGAAAACGGTACAGGAACTCATGTTCGACGATAGGTTTACGGAGGTGGCCCGTCACGCTACGCGGTTTGGCGACATCATCGGTGTAAATTACGACCTTGCCCTTAACCCGTTGTTTCATTACGGAGAACCCATCAAGAACATGGATATCGTCTACGGTAAACTGTTTAAAAAGTCAGACTTTAAACGCGTAAAGAAGATGGAAGTGTTTCGGTTAATGATATGGGCCTATTTAAGCAAACAAGACACGGGAATAGAGTTCTCGGACAACGATTCGCAGGATATCTACACGTTATTTCAAACGTCCGATAACGTCATCCACAGTGATATGACAGAGAAGTTTAAAGAGTATATATTCGGAGGA---AATCGATCGAGTCGTTGGATATGGTTGAACGAACCCATCGCGAACGACGCAGACATCTACTTGGACGGATTCGCCGTATCGATGTACGACAAAGTGCTCAGTTACGTGTACTCGGAACTCAAGCAGGGTAGGGTAAATAAAAATATGCTGAAACTGGTCTATATATTCGAAACCGACGAGTACATACAATCCGTGTTGTTGCAAATTATATACGATGTACCCGGGGACATTCTATCCATCATAGAAGCCAAAGACGATGCGTGGAAAAAGTATTTCATAGGCCTGTATAAAGAACACTTCATAGACGGTAAAACGTTTAACAGTACCAGAACGTTTAACTCGGACTTGTTCAACGTCGTCGCTAAAATATCTCCTTCGTACTTCGACCCAGAGAAG---GTCATATCCGCATTCGATCACCCTCCCGATAAAGTAAAGTTTTTCGATAAAATGGACATTAACGATACGTATATTTCCAACATCGTATACGAAACTAAAGAGTTAAATATTTCGACCATCGAGGAGTCTCAAAAATGTCAAATATATAACCAAGAAACTAGTTATTATATCAAGGAATATAACACCTATATGTATTTGCACGAGGAAGACCCGTACGTGTTACACAAAGGCATGTTCGTTAAACTCTCGACCGTTCCCCAG---------GATAAAAAGTTTTCGTTATTTAGCGACCATATACTGAAATATTACATCGACGGGAAATTGGCCCGTATAGGCCTCGTCGTAACCGATTATAAA---GACGTACTCGTTGATATTCTATCTCACTTGAAATGCGTAGAAGACGTTACAACCTTCGTTAGGTTTTCTGTGTGTAAGAACTCTAGTGTGATATCCTCCGTCGTACGTACCATACTGGGAAATTTCAACACGTCCGTGATCGTATTATTTCAAAAGTTTTTAAGGGATAATATGTATTACGTGGAGTTATTTTTAGATAACACAAACCATTTAACGGAGAACGATAAAAAGTATTTATTAAACGTAATAAAACACGGTAGAACA
TRN  10010101100011000
NAM  Q9DHS5_YLDV/1-567
ASQ  MDYIRRKYLIYTIENKIDFLKDEVFNKVSNFSLNHVLALKYLIINFSNDVINKDVLNNPNFFVFLHMVKCNQVYDTVLNQSFDLPTLYVKSLIKNYSLFYNFIQTYKTLVQDLIFNKKFIEVVSYIDTFKDVIGVNYDLNLNPLFYNGEPIRNMEIIYDKLFKKTDFKAVEKLSVIRLLIWAYLSKQDTGLIFEDNDSQDIYTLLQKSGQIINSEMTEKFKEYIFPGNNKTSYWIWLKENIFNDNKIFKKYLSTTMYDKILSFIYLELKQGKVNKNMLKLVYTFEEDEYIKSVFLQIIYGVPGDILSIIDSYDEAWKKYFIGMYKDQFIDGNTFLSSRTFNDDLFKVVAKIDPEYFDINK-IISVFDHKPEQINFFNSIDINKTYISNIIYDLKDVNFSNINNLKSCQIYNDDTKYYIKEYNTYLYLNEDDPLILNNGILTKYSTIQP---NKRISLLSKNILKYYIDSNLANIGLVLCNYDGDIIVKIISHLKCIEDVTTFIRFATCKNDSILPSIIKTILANFNVSIIILFQKFLQENIYHVELFLDKSNHFTNNDKKYLLKLIKEGRS
DSQ  ATGGATTATATTAGAAGAAAATACTTAATATATACAATAGAAAATAAAATAGATTTTTTAAAGGATGAGGTTTTTAATAAAGTTTCTAACTTCTCTCTTAATCATGTATTAGCTTTAAAATATTTAATCATTAACTTTTCAAACGATGTAATAAACAAAGATGTTTTGAACAATCCAAATTTTTTTGTTTTTTTACACATGGTAAAGTGTAACCAGGTTTACGACACAGTTTTGAATCAATCTTTTGATTTACCAACTTTATATGTAAAATCATTAATTAAAAACTATAGCTTGTTTTATAATTTTATTCAAACGTATAAAACTTTAGTTCAAGACTTAATTTTTAATAAAAAATTTATAGAAGTTGTATCTTATATAGATACATTTAAAGATGTAATAGGTGTAAATTATGACTTAAACTTAAACCCTTTATTTTATAACGGCGAACCTATACGTAACATGGAAATAATTTACGATAAGTTATTTAAAAAAACAGATTTTAAGGCTGTTGAAAAATTAAGCGTTATAAGGCTACTTATATGGGCGTATCTTAGTAAGCAAGATACAGGTTTAATCTTTGAAGATAATGATTCTCAAGATATATACACATTACTGCAAAAATCTGGTCAAATAATTAATAGTGAAATGACTGAAAAATTTAAGGAATATATATTTCCAGGTAATAATAAAACGAGTTATTGGATATGGTTAAAGGAAAATATATTCAACGATAATAAAATTTTTAAAAAATATTTATCAACAACTATGTATGATAAAATATTAAGTTTTATTTACTTAGAGTTAAAACAAGGTAAAGTTAATAAAAATATGTTAAAATTAGTGTATACTTTTGAAGAAGATGAATACATAAAATCAGTATTTCTTCAAATAATATACGGAGTTCCTGGAGATATCCTTTCTATTATAGATTCTTACGATGAAGCTTGGAAAAAATATTTTATAGGTATGTATAAAGATCAATTTATAGATGGAAATACTTTTTTAAGCTCTAGAACATTTAATGATGATTTATTTAAAGTTGTTGCTAAAATAGACCCAGAATATTTTGATATTAATAAA---ATAATATCTGTTTTTGACCATAAACCTGAACAGATAAATTTTTTTAATAGCATAGACATCAACAAAACATATATATCCAATATTATTTACGATTTAAAAGATGTCAATTTTTCCAATATTAATAATTTGAAAAGTTGTCAAATTTATAACGATGATACAAAATACTATATAAAGGAGTACAATACATATCTTTATCTTAATGAAGATGATCCGTTAATATTAAATAATGGAATATTAACAAAATACTCAACTATACAACCT---------AATAAAAGAATAAGTTTGTTAAGTAAAAATATTTTAAAGTATTATATAGATAGCAACTTAGCTAATATAGGATTAGTTTTGTGTAATTACGACGGTGATATTATTGTAAAAATTATATCTCACTTAAAATGTATAGAAGACGTTACAACATTTATACGCTTTGCAACTTGTAAAAATGATAGTATCTTACCATCAATAATAAAAACCATATTGGCAAATTTTAACGTCTCAATAATTATTTTGTTTCAAAAATTTTTACAAGAAAACATATATCATGTTGAATTATTTTTAGATAAATCAAATCATTTTACTAACAACGATAAAAAATACTTGCTTAAACTAATAAAAGAGGGTAGGTCA
TRN  10010101100011000
NAM  Q98205_MCV1/1-565
ASQ  MDFIRRKYLVHTIERNMDFLRAEVAEKVANFALNHVLALRYLVAQFPRAVLTKDVFANVNFHVFLHVVRCAQVYDAVLRSSFDATTLYVRALVRNYQAFADTVQTYRELCQTLLQDKRFLEVARAAPTLADVIGVNYDTSLNPLFLRGEPVRDMELIFTKLFRKTEFRPVKKLAVLRLLLWAYLCKQDTGLDFADNDAQDLYSLFQKTGPVVHSEMTERFKAFMFAG-EKTSYWVWLQEPVANDADVFKERPARGMYERLLSYLYSELKQGRVNKNMLKLVYIFDSDPSIRSLVLEIIYGVPGDILGVVDSEDETWKAYFVALYREHFVDGRTFTSTQSFFRDLFRVVARVDPEHFGAER-FAALFNAQPEARARFDDMDVNTTFVSRMVYQTPDLDLLALERNRMCQIYSEDTQYYVKEYNTFLFLHEDDPVVIDEGALVRLSSVPS---ERRRLLFSEHVLKYWLDGQLARLGLVLPSYD-DVVLRMVTHMKCLEDVTAFVDYATRRNASMVPAVTRGLLAHFHVPVLVLFQRFLREHLLRVREVLDRSEHLTEREKKYILQIITHGRS
DSQ  ATGGATTTCATCCGCCGCAAGTACCTAGTGCACACCATCGAGCGCAACATGGATTTCCTGCGCGCAGAGGTCGCGGAGAAGGTGGCCAACTTCGCGCTGAACCACGTGCTGGCACTGCGCTACCTGGTGGCGCAGTTTCCGCGCGCCGTGCTGACCAAGGACGTCTTCGCGAACGTAAACTTTCACGTCTTCCTGCACGTGGTGCGCTGCGCACAGGTTTACGACGCGGTGCTGCGCTCGTCCTTTGATGCGACCACGCTCTATGTGCGCGCACTGGTACGCAACTACCAGGCCTTTGCCGACACCGTGCAGACGTACCGCGAGCTGTGCCAGACACTGCTACAGGACAAGCGCTTCTTGGAGGTGGCGCGCGCTGCGCCCACACTTGCGGACGTCATCGGCGTGAACTACGACACCAGCTTGAACCCGCTGTTCCTACGCGGGGAACCGGTGCGCGACATGGAACTCATCTTTACGAAGCTCTTCCGCAAGACAGAGTTTCGCCCCGTGAAGAAGCTGGCGGTGCTGCGCTTGCTACTCTGGGCCTACCTGTGTAAGCAAGACACAGGGCTCGACTTCGCGGACAACGACGCGCAGGACCTGTACTCGCTCTTCCAGAAAACAGGCCCGGTCGTCCACAGCGAGATGACCGAGCGCTTCAAGGCCTTCATGTTCGCGGGC---GAGAAGACCAGTTACTGGGTGTGGCTACAGGAGCCCGTCGCGAACGACGCGGACGTTTTCAAGGAGCGCCCCGCGCGTGGAATGTACGAGCGCCTGCTCAGCTATCTCTATTCAGAGCTCAAGCAGGGCCGCGTGAACAAGAACATGCTCAAGTTGGTTTACATCTTCGACTCGGACCCCAGCATCCGCAGCCTGGTCCTGGAGATCATCTATGGCGTGCCTGGAGACATCCTGGGTGTCGTCGATAGCGAGGACGAGACGTGGAAGGCCTACTTCGTGGCGCTGTACCGCGAGCATTTCGTGGACGGGCGCACTTTCACCAGCACGCAGAGCTTCTTCCGAGACCTTTTCCGCGTGGTCGCGCGCGTGGATCCGGAGCACTTCGGCGCCGAGCGC---TTTGCCGCGCTCTTCAACGCGCAGCCAGAGGCGCGTGCGCGTTTTGACGACATGGACGTCAACACAACCTTTGTCTCACGGATGGTCTACCAGACGCCGGACCTGGACCTGCTCGCGCTGGAGCGCAACCGCATGTGCCAAATCTACAGCGAGGACACGCAGTACTATGTGAAGGAGTATAACACCTTCTTGTTCCTGCACGAGGACGACCCTGTGGTCATCGACGAGGGCGCACTGGTTCGGTTGTCAAGCGTGCCAAGC---------GAGCGGCGCCGCTTGCTCTTTAGCGAGCACGTGCTCAAGTACTGGCTGGACGGGCAGCTGGCGCGCCTGGGGCTGGTCTTGCCCAGCTACGAC---GACGTGGTCCTGCGTATGGTCACGCACATGAAATGCCTGGAGGACGTGACTGCCTTCGTGGACTACGCCACACGTCGTAACGCTAGCATGGTACCCGCTGTCACACGCGGACTGCTGGCGCACTTCCACGTCCCGGTACTGGTGCTTTTCCAGCGCTTCCTGCGCGAGCACCTGTTGCGCGTGCGCGAGGTGCTGGACCGCAGCGAGCACCTCACGGAGCGCGAGAAGAAGTACATCCTGCAGATTATCACGCACGGACGCTCG
TRN  11011101101011001
NAM  V096_FOWPV/1-571
ASQ  MDFIRRKYLIYTVENNINFFTQELADKISNFCLNHVVAINYIIKKYHKSVLTKDIFNNTNFYIFLHFIRDCETYDIVLKSSFDVTLLYLNQLVKNYTSFTDFIDIYKQQSNTLLDDKRFLFVTKLSPYFQDIISVNFSTELNPLFHLNEPIKDLEIIYSKLFKETRFIKVDRISVLRLLIWAYSLKMDTGMKFDDNDSHDLYTILQKTGPVVSSIMTETFKEFVFPKNSTTSYWLFMKERIYNDEKVYTNEPAITIYEKVLSYIYSEIKQARVNKNMLKVVYMLDSDSEIKKFMLELIYGIPGDILSIIDERDETWKSYFVDFYHDNFIDDKTFTSANRFYDDLFNVIAKIDPEKFDIRRDIESIFRTDATLVKRFDDMKINSTYVSQMIYQTQNVDLLALENKKLCQIYNKDTEYAIKEYNTYLYLNEDNPIVIYKGELKKLSDLDLNSPSIVFSLFSKSLLKYYLDSKLASLGLIIENYKDDIILKIITGSSCLQNFTSFIVYATCNDKSILKSVVRTIINHFKVAIIILFKQFLQENIYYVNEYLDNTKHLSKNDKKFILQIINGNYD
DSQ  ATGGATTTTATAAGAAGGAAATATCTTATATATACTGTAGAAAACAATATTAATTTCTTTACGCAAGAACTAGCGGATAAGATATCAAACTTTTGTCTTAATCACGTCGTAGCTATTAACTATATTATTAAAAAGTATCATAAATCAGTGCTGACTAAGGACATTTTTAATAATACCAATTTTTATATATTTTTGCATTTCATAAGAGACTGTGAAACATACGATATAGTTCTTAAGTCGTCTTTCGATGTAACTCTTTTATACCTAAACCAGTTAGTAAAAAACTATACATCTTTTACAGATTTTATTGATATTTATAAACAACAGTCTAATACACTCCTGGATGACAAACGTTTCTTATTCGTAACAAAACTTTCACCTTACTTTCAAGATATTATAAGCGTTAACTTTAGTACTGAGTTAAATCCTTTATTTCACTTGAATGAGCCTATTAAAGACTTAGAGATAATATATTCCAAACTCTTTAAGGAAACTAGATTTATCAAAGTAGACAGGATAAGTGTGTTACGACTTCTAATATGGGCCTATTCGCTAAAAATGGATACAGGGATGAAATTTGATGATAATGATAGTCACGATCTGTATACTATATTACAGAAAACGGGACCTGTAGTCAGCAGTATAATGACAGAAACATTTAAAGAATTTGTATTTCCAAAAAATAGTACTACGAGTTATTGGTTGTTTATGAAAGAAAGAATCTATAATGATGAGAAAGTATATACGAATGAACCCGCGATCACGATTTACGAAAAGGTATTAAGTTATATCTACTCAGAAATTAAACAAGCTCGTGTTAATAAGAATATGTTAAAAGTTGTATATATGTTGGATAGCGATAGCGAAATTAAGAAATTTATGTTGGAATTAATATATGGTATACCAGGTGATATCCTTTCTATTATAGACGAAAGGGATGAAACCTGGAAATCATATTTTGTTGATTTTTATCATGATAACTTTATAGATGATAAAACATTTACATCCGCTAATAGATTCTACGACGATTTGTTTAACGTGATTGCTAAAATAGACCCGGAAAAGTTTGATATAAGAAGAGACATAGAATCTATATTCAGAACAGACGCTACTTTAGTAAAGAGATTTGATGATATGAAAATAAATTCTACATATGTTTCTCAAATGATATACCAAACACAAAATGTAGACTTGCTAGCGTTAGAAAATAAAAAACTTTGTCAGATATATAATAAAGATACAGAATATGCTATAAAAGAGTATAATACTTATTTATACTTAAATGAGGATAATCCCATAGTCATTTATAAAGGAGAGCTAAAAAAACTATCTGATTTAGATCTTAATTCACCCTCTATTGTTTTTTCTTTATTTAGTAAAAGTCTTTTGAAATACTATCTTGATTCTAAATTAGCATCGTTAGGGTTAATAATAGAAAACTATAAGGATGATATAATCCTTAAAATCATAACGGGATCTAGTTGTTTACAAAACTTTACTTCTTTTATAGTTTATGCAACCTGTAATGATAAATCTATACTTAAATCAGTTGTGCGTACAATTATTAATCATTTTAAAGTAGCTATTATTATATTATTTAAACAGTTTCTACAAGAAAACATATATTATGTTAATGAATATCTAGACAATACTAAACATTTATCTAAAAATGATAAAAAATTTATATTACAAATAATCAACGGCAATTATGAC
TRN  10010101100011000
//