EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04631 - Baculo_44)
FAM  PF04631
PID  Baculo_44
DES  Baculovirus hypothetical protein
IPR  IPR006725
ANO  8
ALN  377
AID  0.536054
APH  (((((Q9J8A0_9NUCL/33-406:0.24625,Q99GT0_9NUCL/5-377:0.20435):0.04608,Q9YMK8_NPVLD/3-375:0.25432):0.05040,Y022_NPVOP/4-376:0.41379):0.08299,Q9J1I7_NPVST/3-375:0.34422):0.11186,(Q9PYZ8_GVXN/3-374:0.43875,Q9DVZ5_9BACU/3-368:0.40705):0.12585,Q9QAB4_9NUCL/6-379:0.55705);
ATP  (((((Q9J8A0_9NUCL/33-406,Q99GT0_9NUCL/5-377),Q9YMK8_NPVLD/3-375),Y022_NPVOP/4-376),Q9J1I7_NPVST/3-375),(Q9PYZ8_GVXN/3-374,Q9DVZ5_9BACU/3-368),Q9QAB4_9NUCL/6-379);
ATL  3.28296
DNO  8
DLN  1131
DID  0.557065
DPH  ((Q9J1I7_NPVST/3-375:0.32114,Q99GT0_9NUCL/5-377:0.24581):0.04922,((Y022_NPVOP/4-376:0.30064,Q9YMK8_NPVLD/3-375:0.15103):0.08367,Q9J8A0_9NUCL/33-406:0.20263):0.06200,(Q9DVZ5_9BACU/3-368:0.37153,(Q9PYZ8_GVXN/3-374:0.41764,Q9QAB4_9NUCL/6-379:0.44646):0.09091):0.13763);
DTP  ((Q9J1I7_NPVST/3-375,Q99GT0_9NUCL/5-377),((Y022_NPVOP/4-376,Q9YMK8_NPVLD/3-375),Q9J8A0_9NUCL/33-406),(Q9DVZ5_9BACU/3-368,(Q9PYZ8_GVXN/3-374,Q9QAB4_9NUCL/6-379)));
DTL  2.88031
RID  0.536054
RPH  (((((Q9J8A0_9NUCL/33-406:0.24625,Q99GT0_9NUCL/5-377:0.20435):0.04608,Q9YMK8_NPVLD/3-375:0.25432):0.05040,Y022_NPVOP/4-376:0.41379):0.08299,Q9J1I7_NPVST/3-375:0.34422):0.11186,(Q9PYZ8_GVXN/3-374:0.43875,Q9DVZ5_9BACU/3-368:0.40705):0.12585,Q9QAB4_9NUCL/6-379:0.55705);
RTP  (((((Q9J8A0_9NUCL/33-406,Q99GT0_9NUCL/5-377),Q9YMK8_NPVLD/3-375),Y022_NPVOP/4-376),Q9J1I7_NPVST/3-375),(Q9PYZ8_GVXN/3-374,Q9DVZ5_9BACU/3-368),Q9QAB4_9NUCL/6-379);
RTL  3.28296
LNK  Q99GT0_9NUCL/5-377:Q99GT0:AF334030
LNK  Q9DVZ5_9BACU/3-368:Q9DVZ5:AF270937
LNK  Q9J1I7_NPVST/3-375:Q9J1I7:AF216302
LNK  Q9J8A0_9NUCL/33-406:Q9J8A0:AF169823
LNK  Q9PYZ8_GVXN/3-374:Q9PYZ8:AF162221
LNK  Q9QAB4_9NUCL/6-379:Q9QAB4:AF121349
LNK  Q9YMK8_NPVLD/3-375:Q9YMK8:AF081810
LNK  Y022_NPVOP/4-376:O10281:U75930
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9QAB4_9NUCL/6-379
ASQ  IVITILVLLGIYIFTKPLLDTIYVIQTAQTKYVDTIDENVEAIEKNLAESRYVPLENLANIDINNSTELMN--GENKCFAAPIRVSNVETSTFDCTTVCENESASYFFVDENDIFVINGSRLSSGGYCSTTALPTKCNRETSIVLYSVNTWTCIAEDPRFFAGESNSVQIAGRQHSRFILSGYEQYNILYDKLLENEVDITRNTLRTSWDELLDDGT.RRFVVLCNALDVNYNEMFVNPYNEIECLPNVCTNVQYAHRDVKPDFVNGVCDCGDYSVTRMQHVTSGDETSLCANIINESDYDNNVYKFRSDCLKMTDVVSKLETDGVRLFCPPDVFNTTGDAAYQVEVKGFACRTNNGVDELTYRLENDFGDRLTYIN
DSQ  ATTGTCATTACCATATTAGTATTGTTGGGAATATACATATTTACAAAGCCACTGTTGGACACAATATATGTGATCCAAACAGCACAGACCAAGTATGTTGATACTATAGACGAAAACGTGGAAGCTATAGAAAAAAATTTGGCCGAAAGTCGGTATGTTCCATTAGAAAATTTAGCCAATATAGATATCAATAACAGTACAGAATTAATGAAT------GGCGAAAATAAATGTTTCGCAGCTCCTATACGTGTGTCAAACGTCGAGACGTCTACGTTTGATTGCACAACTGTCTGTGAAAATGAATCAGCCAGTTATTTTTTTGTAGACGAAAACGATATATTTGTAATAAATGGTAGCAGATTATCTTCTGGTGGTTATTGCTCGACAACGGCATTACCCACAAAATGTAATAGAGAAACGTCCATAGTTTTATACAGTGTTAACACATGGACATGTATTGCAGAAGATCCACGCTTTTTTGCTGGCGAATCAAATTCAGTTCAAATAGCCGGTCGTCAACACAGCCGATTCATATTATCGGGTTATGAACAATATAACATTCTGTATGATAAACTTTTAGAAAATGAAGTCGATATTACTCGAAATACTTTGCGTACTTCTTGGGATGAATTATTGGACGATGGCACA...CGTCGATTTGTAGTATTGTGCAATGCTTTAGATGTAAACTACAACGAAATGTTCGTTAATCCTTACAACGAAATAGAATGTTTGCCGAATGTTTGCACCAACGTTCAATATGCACACCGCGACGTAAAACCAGATTTCGTTAACGGGGTGTGCGATTGTGGCGATTACAGCGTGACGCGTATGCAGCATGTAACAAGCGGAGACGAAACTAGTTTATGTGCAAATATTATTAACGAATCAGATTATGATAATAACGTATACAAATTTCGATCTGATTGTTTGAAAATGACAGATGTTGTAAGTAAATTGGAAACAGATGGTGTGCGTTTGTTTTGTCCACCAGATGTTTTCAATACCACAGGTGATGCTGCATATCAGGTCGAAGTCAAAGGGTTTGCTTGCAGAACAAATAATGGTGTCGATGAATTGACGTATCGATTAGAAAATGATTTCGGAGATAGGTTGACGTATATCAAC
TRN  10010101100011000
NAM  Q9YMK8_NPVLD/3-375
ASQ  LLLVVLSVIFLYIIFKPLHGAHARIRDAQAAYDAALDERVDLIADALRRRRYVPMERLPRVNFNTNLGTLN-EGELKCMSTPVFVSAFDTPTFDCAHLCDNPTAQYFYVGAGDKFVVGDQLLEQGGYCTTSSVPRNCNRETSVVLQSLNQWTCIAEDPRYFAGPQNMSQVAGRQHAARIAPGQIERNVLFDRLLGAPVDVSRNTFRSHWDELLADGT.RRFEMRCDALDDHYNRMFVNPLNPIECLPNVCTKVNYAHPDVRPNFETGECECGDFGVTRVTHMDPNDRTSVCVGIVDAFNADALSHEFRVDCISLDTPIDEFDAS--KPLCPGTAFIQNTDAAYTFTLPGTFPISITGLHEPPHRFYMDTRSRVDYPI
DSQ  CTACTGCTCGTCGTTCTGAGCGTGATATTTTTATATATAATTTTTAAACCGCTGCACGGCGCCCACGCGCGAATCCGAGACGCGCAGGCCGCGTACGACGCCGCGCTCGACGAGCGCGTGGACCTGATCGCCGACGCGCTCCGCCGGCGACGGTACGTGCCCATGGAGCGGTTGCCGCGCGTCAACTTCAACACGAACCTGGGCACCCTGAAC---GAGGGCGAGCTCAAATGCATGTCGACGCCCGTGTTCGTGAGCGCGTTCGACACGCCGACGTTCGATTGCGCGCACCTGTGCGACAACCCGACCGCCCAATACTTTTACGTGGGCGCCGGCGACAAGTTCGTGGTGGGCGACCAGCTGCTCGAGCAAGGCGGCTACTGCACGACGAGCAGCGTGCCCCGGAATTGCAACCGCGAAACCAGCGTGGTGCTGCAGAGTCTCAACCAGTGGACGTGCATCGCCGAGGATCCGCGCTACTTTGCCGGCCCGCAGAACATGAGCCAGGTGGCGGGCCGGCAGCACGCGGCCCGCATCGCGCCCGGCCAGATCGAGCGCAACGTGCTGTTCGACCGGCTGCTCGGCGCGCCCGTGGACGTGTCTCGGAACACGTTTCGCTCGCATTGGGACGAGCTGCTGGCGGACGGCACG...CGGCGGTTCGAGATGCGCTGCGACGCGCTCGACGACCACTACAACCGCATGTTCGTGAACCCGCTCAACCCGATCGAGTGTCTGCCCAACGTGTGCACCAAGGTGAACTACGCGCACCCGGACGTGCGGCCCAACTTCGAGACGGGCGAGTGCGAGTGCGGCGACTTTGGCGTGACGCGCGTCACGCACATGGACCCCAACGACCGCACCTCCGTGTGCGTGGGCATCGTGGACGCCTTCAACGCGGACGCGCTGTCGCACGAGTTCCGCGTCGATTGCATCAGTCTGGACACGCCGATCGACGAGTTCGACGCCAGC------AAACCGCTGTGCCCCGGCACCGCGTTCATCCAGAACACGGACGCCGCGTACACGTTCACCTTGCCCGGCACCTTTCCCATCTCGATCACCGGCCTCCACGAGCCGCCTCACCGATTTTACATGGACACGAGGAGCAGAGTCGATTACCCCATC
TRN  10010101100011010
NAM  Q99GT0_9NUCL/5-377
ASQ  LLLFVLLVIFLYVLYRPMHLAWRFMLKAQREYNETIDDRIDYMQEVLRRRQYVPLHSLPNINFNTNLGTIN-DGELKCLSVPVFVGPVETPNFDCTETCDNPSAFYFFVGEYDKFVVNGELLDRGGYCTTNSIPRNCNRETSVILHGLNQWTCIAEDPRYFAGPQNMSQVAGRQHADRIFPGQIGRNILFDRLLGTEVDVSRNTFRSHWDELLPDGT.RRFEMRCNALDDHENRMFLNPLNPIECLPNVCTNVRRVALSVRPNFSTGECECGDVNETRVTHIVPGDKTSMCAAVVDRFNRDLMSHQLRVDCITRDMPMSKWHKD--MILCPPDVFVQNSDNAFYFTLPGSFPISETGVYEPTYRFYMQTRNRVNYDI
DSQ  CTGCTATTGTTTGTGTTGCTAGTGATATTTCTGTATGTTCTTTACCGGCCAATGCATTTGGCATGGCGATTTATGCTCAAAGCTCAGCGCGAATATAACGAAACTATCGATGACAGAATAGATTACATGCAAGAAGTATTGCGGCGACGACAATATGTGCCGTTACATTCGTTGCCGAATATCAATTTCAATACAAACTTGGGCACAATTAAC---GATGGTGAACTGAAATGTTTATCGGTGCCGGTGTTTGTGGGACCAGTGGAAACGCCCAATTTTGATTGTACCGAAACGTGCGACAATCCGTCAGCTTTTTATTTTTTTGTTGGTGAATACGATAAGTTCGTTGTTAACGGCGAGTTGTTGGATCGCGGCGGTTATTGTACAACCAATAGTATACCGCGTAATTGTAATCGCGAAACAAGCGTAATTTTACACGGTCTAAATCAATGGACATGCATCGCGGAAGATCCTCGATATTTTGCCGGTCCGCAAAATATGAGTCAGGTAGCCGGCAGGCAACATGCCGATCGAATATTTCCGGGTCAAATTGGTCGCAACATATTGTTTGACCGTTTGTTGGGAACAGAAGTCGACGTGTCCAGAAACACGTTTCGTAGTCATTGGGACGAACTGTTGCCGGACGGTACT...AGACGATTCGAAATGCGCTGTAACGCTTTAGACGATCATGAAAACCGTATGTTTCTCAATCCACTCAATCCAATAGAATGTTTGCCCAATGTGTGCACAAACGTGCGCAGAGTAGCGCTTAGCGTTCGTCCTAATTTTTCTACAGGCGAATGTGAATGCGGTGATGTTAACGAAACGCGCGTCACTCATATTGTGCCCGGCGATAAAACTTCGATGTGTGCCGCTGTCGTGGACCGTTTCAATCGTGATCTAATGTCGCATCAACTCAGAGTCGATTGTATCACAAGGGACATGCCCATGTCAAAGTGGCACAAAGAC------ATGATTCTGTGTCCGCCAGACGTGTTCGTACAAAATAGCGACAACGCTTTTTATTTTACTTTGCCTGGATCTTTTCCCATATCGGAAACGGGTGTTTACGAACCAACGTATAGGTTTTATATGCAAACCAGAAATAGAGTCAACTATGATATT
TRN  10010101100011000
NAM  Q9J8A0_9NUCL/33-406
ASQ  LLMIVCVVIFLFLLCKPIYDAHLEIKKSQTDYNETVDERIDYMRNVLQRRRFVPLSALPNIVFNTNLGTIN-EGESKCLSVPIYVGFSNTPNFDCTVLCDNPAAVYFYADEYDKFVINGQMLLRGGYCTTSSVPRNCNRETSVIIHSLNQWSCIAEDPRYFSGIQNINQVAGRQHIDRIAPGQANRNVLFDRLLGVEVDVTRNTFRSHWDEEMPDGSgRRFEMRCNALDDHNNRMFVNPFNPIECLPNVCTNVNFVMPDVRPNFETGECECGDFEVTRVRHLDPDDKTSMCAAVVDTFDERTLSLQYRVDCMNLDMPVEKYDRN--MLWCPSNIFNQNTDNAFLFTVPGSFPISGNGIDEPTWRLYMEMRNRIEFNV
DSQ  CTGCTAATGATCGTTTGTGTGGTAATATTTTTATTTTTACTATGCAAACCAATTTACGACGCCCACTTGGAAATTAAAAAGTCGCAGACCGACTATAACGAAACCGTCGACGAGCGCATCGACTATATGCGCAACGTGTTGCAGCGTAGACGATTCGTTCCGCTCAGCGCTCTACCCAATATCGTGTTTAACACGAATCTGGGTACGATCAAC---GAGGGCGAATCCAAGTGTCTGTCGGTGCCGATATACGTAGGTTTCTCGAACACGCCTAACTTTGACTGTACCGTGCTCTGCGATAATCCCGCCGCCGTCTACTTTTATGCCGACGAATACGACAAGTTTGTCATCAACGGACAAATGTTACTGCGCGGCGGCTATTGCACGACGAGCAGCGTGCCGCGAAACTGTAACCGCGAGACGAGCGTAATCATTCACAGTTTGAATCAGTGGTCGTGTATTGCCGAGGATCCGCGTTACTTTAGCGGTATTCAAAACATTAACCAGGTGGCGGGACGGCAGCACATTGATCGCATCGCGCCCGGTCAGGCAAATCGCAACGTCCTGTTCGATCGACTGCTCGGTGTCGAAGTGGACGTTACGCGAAACACGTTTCGCAGTCACTGGGACGAAGAGATGCCCGACGGCAGCgggCGTCGTTTCGAGATGCGCTGCAACGCTCTCGACGATCACAACAACAGAATGTTCGTGAATCCCTTCAATCCGATCGAGTGTCTGCCCAACGTGTGCACCAATGTCAACTTTGTGATGCCCGACGTCCGGCCAAACTTTGAGACGGGCGAATGCGAATGCGGCGATTTTGAAGTGACTCGAGTGCGCCACCTCGATCCCGACGACAAAACGTCCATGTGCGCCGCCGTAGTAGATACGTTTGACGAGCGCACACTGTCTTTGCAGTATCGCGTCGATTGCATGAATCTCGACATGCCCGTCGAAAAATACGATCGCAAC------ATGTTATGGTGTCCCTCGAACATTTTCAACCAAAACACCGACAACGCTTTCCTATTCACCGTGCCCGGCTCGTTTCCCATCTCGGGCAACGGCATCGACGAACCGACGTGGCGTCTCTATATGGAGATGCGGAATCGTATCGAGTTTAACGTC
TRN  10010101100011010
NAM  Q9J1I7_NPVST/3-375
ASQ  VVIFILLIIFVLALARPMQVAYETIRKRQIDYENRIDERIGYMQNVLSRRRYVPLSSLPNIDFGATLETIS-EGEIRCLSVPAFVSRFNTPNFDCTEMCDDPSASYFYVGPFDRFVVNGEMLTSGGYCTTNSVPRQCNRETSVIVHGLNQWTCIAEDPRYFAGEQNMIQTAGRQHIDFIRSDEIDRIVLFDRQLGVPVDVSRNTFRSHWDETMADGS.RRFEVRCDARDINNNSMFINPLNPIECLPNVCTNVQYVHPSVRPDFERGVCDCGDPDETRVVHVDPNDPSSMCASIVHNLNQSELTYEFRIECINMNTPVSRIRAN--MLLCPDHLMESTGDAAYTFVMPGAFPMSSNGIEEPNYRLWLDVRNRVNFFQ
DSQ  GTGGTGATTTTTATATTGTTGATAATTTTTGTGTTGGCGTTGGCGCGTCCTATGCAAGTCGCGTACGAGACCATACGCAAACGACAAATTGATTACGAGAATCGAATCGATGAACGGATCGGCTACATGCAAAACGTGCTCAGCCGACGGCGCTACGTGCCGCTGAGCTCGTTGCCTAACATTGATTTTGGTGCCACGCTCGAGACGATCTCC---GAAGGAGAGATTCGATGTCTGTCCGTGCCGGCGTTTGTGAGTCGATTCAACACGCCCAACTTTGATTGTACCGAAATGTGCGACGATCCTTCGGCGTCGTACTTTTACGTAGGACCGTTCGATCGGTTTGTAGTGAACGGTGAAATGCTTACTAGCGGCGGCTACTGCACTACAAACAGCGTACCTCGCCAATGCAACCGCGAGACTTCGGTGATCGTGCACGGTCTCAATCAGTGGACGTGCATAGCCGAAGATCCCAGATACTTTGCCGGAGAACAAAACATGATCCAAACCGCGGGCAGGCAACATATCGACTTTATACGTAGCGACGAGATCGATAGGATTGTACTGTTCGATCGTCAATTGGGCGTACCCGTGGACGTGTCTCGTAACACATTTCGGAGCCATTGGGACGAGACGATGGCGGACGGATCG...AGAAGGTTCGAAGTGCGATGCGACGCCCGAGACATTAACAACAATTCAATGTTCATAAATCCTCTAAACCCGATCGAATGTCTACCGAACGTGTGCACGAACGTGCAATACGTTCATCCTTCCGTTAGGCCAGATTTTGAGCGAGGCGTGTGCGACTGTGGCGATCCGGACGAGACCAGAGTCGTTCACGTCGATCCGAACGATCCCAGTTCGATGTGCGCTTCGATTGTGCACAATTTGAATCAAAGCGAGCTAACGTACGAGTTTAGAATAGAATGCATCAACATGAACACGCCCGTCAGTCGGATTCGCGCAAAC------ATGCTGCTGTGTCCCGATCATTTGATGGAATCGACAGGCGACGCGGCATACACTTTTGTGATGCCCGGCGCGTTTCCAATGTCATCGAACGGTATAGAGGAGCCAAACTACAGACTATGGTTGGACGTGAGGAACAGAGTCAACTTTTTCCAA
TRN  10010101100011001
NAM  Y022_NPVOP/4-376
ASQ  ILIVLFLFALLYIVVWPFYQAFYHINHAQQDYNMTLTDRMDYIEAVMRRRQYVPMEALPVVRFDTNLGTLA-GETLRCMSVPLYVSEIDLPMFDCGEVCEDPNAVYFFVGEGDTYVVNGHKLAVGGYCTTNSVPRDCNRETSVVLMSLNQWTCIAEDPRYFAGTGNMTQLAGRQHFDRILPGQSGRNVLFDRLLGREVNVATNTFRRSWDELLEDGS.RRFEMRCNARDNNNNLMFVNPRNPLECLPNVCTDVNYVHSTVRPVFESGECDCGDEAVTRVRHVVPGDRTSMCASIVDGFDTNTASHRFRVECVNTHTPIDRFSSD--KLLCPSDTFDSNTDAAFAFEVPGSYPLSGNGLDEPTHRVFLDTRSRVQYND
DSQ  ATACTGATTGTGCTTTTCCTGTTTGCGCTGCTTTATATAGTGGTTTGGCCCTTTTATCAGGCCTTTTATCACATAAACCACGCCCAGCAAGATTACAACATGACCTTGACTGATAGGATGGACTATATAGAGGCGGTCATGCGGCGTCGCCAGTATGTTCCCATGGAGGCGCTTCCCGTGGTGCGTTTCGACACCAACCTGGGCACCTTGGCG---GGAGAAACCCTAAGATGCATGTCCGTGCCCTTGTACGTTAGCGAAATAGACCTGCCCATGTTTGACTGCGGCGAGGTGTGCGAGGACCCCAACGCGGTCTACTTTTTTGTGGGGGAGGGCGACACGTATGTGGTCAACGGGCACAAGCTGGCGGTGGGCGGGTACTGCACCACCAACAGCGTGCCGCGAGACTGCAACCGCGAGACCAGCGTGGTGCTCATGAGCCTCAACCAGTGGACGTGCATTGCCGAAGACCCGCGCTACTTTGCCGGCACCGGCAACATGACCCAGCTGGCGGGGCGCCAGCACTTTGACCGCATCCTGCCCGGCCAGAGCGGCCGCAACGTGTTGTTTGACCGGCTGCTGGGCCGCGAGGTCAACGTCGCCACCAACACGTTTCGACGCAGCTGGGACGAATTGCTCGAGGACGGCTCG...CGGCGGTTTGAAATGCGCTGCAACGCGCGAGATAACAACAACAACCTCATGTTTGTAAACCCGCGCAACCCCCTGGAATGCCTGCCCAACGTGTGCACCGACGTGAATTATGTGCACTCCACCGTGCGGCCCGTGTTTGAGTCGGGCGAGTGTGACTGCGGCGACGAGGCCGTCACGCGCGTGCGTCACGTGGTGCCCGGCGACCGCACGTCCATGTGCGCCAGCATTGTGGACGGGTTCGACACCAACACGGCGTCCCACAGGTTTCGCGTGGAATGCGTGAACACGCACACCCCAATTGACCGCTTCTCCAGCGAC------AAGCTGCTGTGTCCCAGCGACACGTTTGACAGCAACACGGACGCGGCGTTTGCCTTTGAGGTGCCCGGCTCGTACCCGTTGTCTGGAAACGGCCTGGACGAGCCCACACACCGGGTTTTTCTGGACACGAGGTCGCGCGTGCAATACAATGAC
TRN  10010101100011011
NAM  Q9PYZ8_GVXN/3-374
ASQ  WLLTSLFIILLYLIYSPLQRTYQQIKLETEATNKILDDP-EYLER-MIRRRYAPLHALPRVEFNASFDTLEGPGGGHCFSQPVRVSRQDLVTYDCASLCDDVRAAYFYVGPYDRLVVDGNELQEGGYCTTNSVPRNCNRETSILLHSINHWTCIAEDPRYYAGRTGLIQTAGRQHYNRIRPGFYVLNTLWDTLLDREVDPTINTFRRTWDDVNEDGT.RRFQVRCNAPDEKGNAMFVNPRNPIECLPNVCTNMQFAVRTVLPNFETGECDCGDYNDTRVTHLDRWDKSSVCVSVVDRRNVSDRSYIFRVPCISMDMPINQYRDD--VLLCPPHLINTNTDNAYEFILYGVVPLSGNDIHEPTTQLINDTRSRINWRD
DSQ  TGGTTGCTAACATCTTTGTTTATTATTTTATTATACCTCATATATTCACCCTTACAGCGCACTTATCAACAAATAAAATTAGAGACCGAAGCCACTAATAAAATACTGGACGATCCA---GAATATTTAGAAAGA---ATGATACGTAGACGTTACGCACCATTACACGCTCTACCTAGAGTGGAGTTTAATGCTAGCTTTGATACTTTAGAGGGCCCAGGCGGAGGGCATTGTTTTTCGCAACCAGTACGAGTATCCAGACAAGATCTTGTCACATACGACTGCGCATCGCTATGCGACGATGTACGCGCAGCTTACTTTTACGTAGGCCCTTACGATCGTCTAGTGGTGGACGGCAACGAGTTACAAGAAGGTGGGTATTGTACTACAAACTCTGTACCCAGAAACTGTAACAGAGAAACGTCCATATTGTTACATTCCATCAATCATTGGACTTGCATCGCCGAGGACCCCAGATATTACGCGGGTCGAACAGGTTTAATACAGACGGCTGGGAGACAGCACTATAATAGGATCCGTCCTGGCTTTTACGTTCTTAACACACTGTGGGACACTTTGCTTGACAGAGAAGTTGATCCCACCATCAATACTTTTAGGCGGACTTGGGACGATGTTAATGAGGATGGTACC...AGGCGATTTCAAGTTCGGTGTAATGCCCCCGACGAAAAAGGTAATGCCATGTTCGTTAATCCCAGAAACCCCATAGAGTGTCTACCAAACGTGTGCACAAACATGCAGTTTGCAGTCAGAACGGTTTTGCCCAATTTTGAAACTGGCGAATGTGACTGTGGTGACTACAACGACACACGAGTGACGCATCTAGACAGATGGGACAAGAGTTCGGTTTGTGTTAGCGTGGTTGACAGACGTAACGTGTCGGACAGGTCTTATATTTTTAGGGTACCCTGTATTTCTATGGATATGCCTATTAATCAATACAGAGACGAC------GTGTTACTATGCCCACCACATCTCATCAACACAAACACAGACAACGCCTACGAATTTATACTATACGGTGTGGTACCGCTGAGTGGTAACGATATTCACGAACCTACAACGCAGTTGATCAACGACACGAGAAGCCGTATAAATTGGCGTGAC
TRN  10010101100011000
NAM  Q9DVZ5_9BACU/3-368
ASQ  WLGCVLVLLFIYLMYHPLHMAFYDVVDDAEERNRLLND--ETFRRQLRDRRYAPLHTLPSVSVNVD------GPATGCFSTPTLVTRNDVPSFDCSAVCGTEASAYFYVDEHRKVAVDGVLLGVGGYCTTNSVPRLCNSETSILLYGANQWTCIAEDPRYFAGEANMIQMAGRQHSELVNGEQLRKNVLWDNLLNVEVNPTANTFRRSWDDVMEDGK.RRFEVRCDALDLKHNAMFVNPYNAIECLPNVCTDVNHAHPDVRPDFVTGFCECGDQNVTRVRHIQEEDRTTKCASIVNRVHRDANTADFRVDCLSLDSPVSSFSRD--KLLCPPSIFNTNSDFAYTFTLRGVNNVSGNGIHEPTYRLWADTRSRIRWKT
DSQ  TGGCTCGGTTGCGTGCTCGTGTTGCTGTTTATTTATCTCATGTACCACCCGTTGCACATGGCGTTTTACGACGTGGTGGACGACGCCGAGGAGCGCAACCGACTGCTCAACGAC------GAGACGTTTAGACGCCAGCTGCGGGACCGCCGTTACGCGCCTCTCCACACCCTGCCGAGCGTGAGCGTGAACGTCGAC------------------GGGCCCGCGACGGGATGTTTTTCTACCCCCACCCTGGTGACGCGAAACGACGTGCCCTCGTTCGACTGCAGCGCCGTCTGCGGCACCGAAGCGTCCGCGTATTTTTACGTCGACGAGCACCGCAAGGTGGCCGTGGACGGGGTGCTCCTCGGCGTCGGCGGTTACTGCACGACCAACTCGGTGCCGCGTCTGTGTAACAGCGAAACGTCGATACTGCTGTACGGCGCTAACCAGTGGACGTGCATAGCGGAGGACCCCCGTTACTTTGCCGGCGAGGCCAACATGATTCAGATGGCGGGCAGACAGCACAGCGAGCTGGTGAACGGCGAACAACTGCGCAAGAACGTGCTCTGGGACAATCTGCTGAACGTCGAAGTGAATCCGACCGCGAACACGTTCAGACGCAGCTGGGACGACGTAATGGAGGACGGTAAG...CGCCGTTTCGAGGTCAGATGCGACGCGCTCGATTTGAAGCACAACGCCATGTTCGTCAATCCGTACAACGCGATAGAATGTCTGCCGAACGTGTGCACGGACGTTAACCACGCGCACCCCGACGTGAGACCGGATTTTGTGACGGGCTTTTGCGAATGCGGCGACCAGAACGTGACTCGGGTACGCCACATACAAGAGGAGGACAGGACCACGAAATGCGCCTCTATAGTGAACCGGGTGCACCGCGACGCCAACACGGCCGATTTCAGAGTCGACTGCCTTTCGCTCGACAGCCCAGTGTCAAGTTTTTCGAGAGAC------AAGCTGCTGTGCCCGCCGTCCATATTCAACACAAACAGCGATTTCGCGTACACGTTCACTTTGCGGGGCGTCAACAACGTGAGCGGTAACGGCATCCACGAGCCGACGTACCGGCTGTGGGCGGACACGCGATCGAGAATAAGGTGGAAGACA
TRN  10010101100011001
//