EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04606 - Ogr_Delta)
FAM  PF04606
PID  Ogr_Delta
DES  Phage transcriptional activator, Ogr/Delta
IPR  IPR007684
ANO  5
ALN  73
AID  0.577345
APH  (((VPB_BP186/1-72:0.20544,OGRK_ECOLI/1-72:0.31797):0.08411,Q37973_9CAUD/1-72:0.11386):0.12359,O87909_RAHAQ/1-69:0.58148,Q54420_SERMA/1-73:0.27955);
ATP  (((VPB_BP186/1-72,OGRK_ECOLI/1-72),Q37973_9CAUD/1-72),O87909_RAHAQ/1-69,Q54420_SERMA/1-73);
ATL  1.70599
DNO  5
DLN  219
DID  0.576006
DPH  (VPB_BP186/1-72:0.18341,((O87909_RAHAQ/1-69:0.54180,Q54420_SERMA/1-73:0.24230):0.12635,Q37973_9CAUD/1-72:0.20675):0.10077,OGRK_ECOLI/1-72:0.26350);
DTP  (VPB_BP186/1-72,((O87909_RAHAQ/1-69,Q54420_SERMA/1-73),Q37973_9CAUD/1-72),OGRK_ECOLI/1-72);
DTL  1.66488
RID  0.577345
RPH  (((VPB_BP186/1-72:0.20544,OGRK_ECOLI/1-72:0.31797):0.08411,Q37973_9CAUD/1-72:0.11386):0.12359,O87909_RAHAQ/1-69:0.58148,Q54420_SERMA/1-73:0.27955);
RTP  (((VPB_BP186/1-72,OGRK_ECOLI/1-72),Q37973_9CAUD/1-72),O87909_RAHAQ/1-69,Q54420_SERMA/1-73);
RTL  1.70599
LNK  O87909_RAHAQ/1-69:O87909:U91484
LNK  OGRK_ECOLI/1-72:P37057:U00096
LNK  Q37973_9CAUD/1-72:Q37973:U49731
LNK  Q54420_SERMA/1-73:Q54420:U11698
LNK  VPB_BP186/1-72:P08711:U32222
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VPB_BP186/1-72
ASQ  MFHCPKCHHAAHARTSRYLTENTKERYHQCQNINCSCTFMTMETIERFIVTPGA-IDPAPPHPTVGGQRPLWL
DSQ  ATGTTTCATTGTCCGAAGTGCCATCATGCCGCACATGCGCGAACAAGCCGCTATCTAACCGAAAACACGAAAGAACGCTACCACCAGTGCCAGAACATCAACTGTAGTTGTACGTTTATGACAATGGAAACGATAGAGCGCTTTATTGTTACTCCGGGAGCC---ATTGACCCGGCACCGCCTCACCCGACTGTCGGTGGTCAGCGGCCATTGTGGCTC
TRN  10010101110011011
NAM  Q37973_9CAUD/1-72
ASQ  MMHCPLCQNAAHARTSRYLSTETKERYHQCQNINCGCTFITFETLSRFIVKPGT-VDPAPPHPIRNQQQQLWL
DSQ  ATGATGCACTGCCCGTTATGCCAAAACGCTGCACATGCTCGCACTAGCCGGTACCTTAGCACCGAAACGAAAGAACGTTATCACCAGTGCCAAAACATAAATTGCGGATGTACATTTATCACTTTTGAGACACTATCAAGATTCATTGTGAAACCGGGGACT---GTTGATCCTGCTCCGCCCCACCCCATCAGAAACCAACAACAGCAACTTTGGCTT
TRN  10010101110011000
NAM  OGRK_ECOLI/1-72
ASQ  MFHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYESVQRYIVKPGE-VHVVRPHPLPSGQQIMWM
DSQ  ATGTTTCATTGTCCTTTATGCCAGCATGCCGCACATGCGCGTACAAGCCGCTATATCACTGACACGACAAAAGAGCGTTATCACCAGTGTCAGAACGTGAATTGCAGCGCCACGTTCATCACTTATGAGTCGGTACAGCGATACATTGTGAAGCCGGGAGAA---GTCCACGTCGTAAGGCCGCACCCGTTGCCGTCAGGGCAGCAAATTATGTGGATG
TRN  10110101110011000
NAM  Q54420_SERMA/1-73
ASQ  MMHCPLCGHVAHTRSSRYLSESTKERYHQCRNINCSCTFATHESVARVIVKPGDDIVPAQPHPPENQHKQSAA
DSQ  ATGATGCACTGTCCACTATGCGGTCACGTGGCCCACACTCGCTCCAGCCGCTATCTGAGCGAGTCGACCAAAGAGCGTTACCATCAATGCCGCAACATCAATTGCAGCTGCACGTTCGCCACGCACGAGTCCGTTGCACGGGTGATCGTCAAACCTGGCGATGATATTGTCCCGGCGCAGCCGCACCCGCCGGAGAATCAACATAAACAAAGCGCCGCC
TRN  11011101101011011
NAM  O87909_RAHAQ/1-69
ASQ  MMRCPLCNHSAHIRTSRYLSQQTKESYYQCQNIECSCTFKTIETVSKILCSPTF----EKTEGAGCNQEESYL
DSQ  ATGATGCGTTGCCCGCTTTGCAATCACTCAGCACATATACGAACCAGTCGATACCTGTCACAGCAAACCAAGGAGTCATATTATCAATGCCAAAACATAGAGTGTTCATGCACTTTTAAAACAATTGAAACCGTTTCTAAAATTCTCTGCAGCCCAACCTTT------------GAAAAAACAGAAGGTGCAGGCTGTAATCAGGAAGAATCCTATTTA
TRN  10010101100011000
//