EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04596 - Pox_F15)
FAM  PF04596
PID  Pox_F15
DES  Poxvirus protein F15
IPR  IPR007675
ANO  5
ALN  137
AID  0.518304
APH  ((VF15_VARV/26-161:0.30968,(Q83606_9POXV/12-148:0.50060,Q9DHT3_YLDV/12-148:0.24632):0.08358):0.28452,O11314_MCV1/1-137:0.24221,V105_FOWPV/12-147:0.48896);
ATP  ((VF15_VARV/26-161,(Q83606_9POXV/12-148,Q9DHT3_YLDV/12-148)),O11314_MCV1/1-137,V105_FOWPV/12-147);
ATL  2.15586
DNO  5
DLN  411
DID  0.549988
DPH  (((VF15_VARV/26-161:0.28544,Q9DHT3_YLDV/12-148:0.26605):0.09572,Q83606_9POXV/12-148:0.29004):0.15270,O11314_MCV1/1-137:0.48768,V105_FOWPV/12-147:0.37489);
DTP  (((VF15_VARV/26-161,Q9DHT3_YLDV/12-148),Q83606_9POXV/12-148),O11314_MCV1/1-137,V105_FOWPV/12-147);
DTL  1.95252
RID  0.518304
RPH  ((VF15_VARV/26-161:0.30968,(Q83606_9POXV/12-148:0.50060,Q9DHT3_YLDV/12-148:0.24632):0.08358):0.28452,O11314_MCV1/1-137:0.24221,V105_FOWPV/12-147:0.48896);
RTP  ((VF15_VARV/26-161,(Q83606_9POXV/12-148,Q9DHT3_YLDV/12-148)),O11314_MCV1/1-137,V105_FOWPV/12-147);
RTL  2.15586
LNK  O11314_MCV1/1-137:O11314:U86897
LNK  Q83606_9POXV/12-148:Q83606:U43549
LNK  Q9DHT3_YLDV/12-148:Q9DHT3:AJ293568
LNK  V105_FOWPV/12-147:Q9J5B5:AF198100
LNK  VF15_VARV/26-161:P33873:X69198
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  V105_FOWPV/12-147
ASQ  MNPFSDMENIVINEKEKCILGNRCFVKLSEVYNMPMCCIDTNQCLTMNRFKFSLNELLYTPFYYKQLQYQYLTPQFIFRCIQEANENNMSCYYCYTKK-KEHNGLNIDIFIPTANSKSYIVIGLRIKDFWKQSFKVN
DSQ  ATGAATCCATTTAGCGATATGGAAAATATAGTCATCAACGAAAAAGAAAAATGTATATTAGGAAACAGGTGTTTTGTCAAACTTTCAGAGGTATATAATATGCCTATGTGTTGTATAGATACCAATCAATGTTTAACTATGAATAGATTTAAATTTAGCTTAAATGAACTACTCTACACACCTTTTTACTATAAACAACTACAATATCAGTATCTAACACCCCAGTTCATATTTAGATGTATACAAGAAGCTAATGAAAACAATATGAGTTGCTATTACTGTTATACTAAGAAA---AAGGAACATAACGGATTAAATATTGATATTTTCATTCCAACTGCAAATTCAAAGTCTTATATAGTTATAGGACTACGTATAAAAGATTTTTGGAAACAATCTTTTAAAGTAAAT
TRN  10010101110011000
NAM  O11314_MCV1/1-137
ASQ  MQPFHDMDRVKINRKENCILGNRCFVKLAEVFHMPRCSVPTSASLCANNHSFTLHELLYSPFHYKQPQYQYLLPSFVFTCIELARKNNQTCYYCKADRANEEGSLNLNIFVPTLARSMYVVIGIRIKDYWVEAFEIV
DSQ  CTGCAGCCCTTCCACGACATGGACCGCGTCAAGATCAACCGCAAGGAAAACTGCATCCTGGGGAACCGCTGCTTCGTAAAGCTGGCCGAGGTCTTCCACATGCCGCGCTGCTCCGTGCCCACGAGCGCCAGCCTGTGCGCCAACAACCACTCTTTCACGCTGCACGAGCTGCTGTACTCGCCGTTCCACTACAAGCAGCCGCAGTACCAGTACCTGCTGCCGAGCTTCGTCTTCACCTGCATTGAGCTCGCGCGCAAGAACAACCAGACGTGCTACTACTGTAAGGCGGACCGCGCGAACGAGGAGGGCAGCCTCAACCTGAACATCTTCGTGCCCACGCTGGCGCGCTCCATGTACGTCGTCATCGGCATCCGGATCAAGGACTACTGGGTCGAGGCCTTCGAGATCGTG
TRN  11011111101111111
NAM  Q9DHT3_YLDV/12-148
ASQ  LNPFKNMNKIKINLNDNCVLGNRCFVKVDKVRFIPYNSVETSKPVMIRGCTFTLPELLYSPFHFQQPQIQYLMPSFVLYCIEEANKNKSTSKYCIIDKNTETDELKINIFVPTFLKSVYVIIGLRIKHFWSSKFKIE
DSQ  TTAAATCCTTTTAAAAATATGAATAAAATAAAAATAAATTTAAACGATAATTGTGTTTTAGGAAACAGGTGTTTTGTAAAAGTAGATAAAGTAAGATTTATACCATACAATTCTGTTGAAACGTCAAAACCTGTAATGATAAGAGGGTGTACATTCACACTGCCAGAACTTTTATATTCTCCTTTTCACTTTCAACAACCTCAAATACAGTATCTTATGCCAAGTTTTGTTTTATATTGTATAGAAGAAGCTAATAAAAATAAAAGTACAAGTAAATATTGTATAATAGACAAAAATACGGAAACTGATGAACTTAAAATAAATATATTTGTTCCAACATTTTTAAAATCAGTATATGTAATAATTGGGTTACGAATAAAACATTTTTGGTCTTCAAAGTTTAAAATAGAA
TRN  10010101100011000
NAM  VF15_VARV/26-161
ASQ  MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSISSSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRGD-DDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE
DSQ  ATGAAACCTTTTAAGAATATGAATAAAATAACAATTAATCAAAAGGATAATTGTATATTAGCAAATAGATGCTTTGTTAAAATAGATACTCCTAGATACATACCATTGACATCCATTAGTAGTTCTAATATCATCAGAATACGGAATCATGATTTTACATTATCTGAACTATTGTATTCACCGTTTCATTTTCAACAGCCTCAGTTTCAATATCTCCTTCCTGGGTTTGTATTAACGTGTATTGATAAAGTTTCGAAACAGCAAAAAGAATGTAAATATTGTATCTCTAATCGTGGAGAT---GATGATAGTTTAAGCATTAATCTATTTATTCCAACTATTAACAAGTCTATATATATTATTATCGGTTTACGGATGAAAAATTTTTGGAAGCCTAAATTCGAAATAGAA
TRN  10010101110011000
NAM  Q83606_9POXV/12-148
ASQ  LNPFKHMNRIKINREEKCLLGSTSFIKIDKVKHIPGNAVNVSKSIHVRGQDFTLSELLYSPLYFQQARGQCIMPHFVLKCIDEAKKNRMVCKYCTVTKSSDPQGLNANIFIPTKTESTYIIIGIRIKSYWSVTFRVE
DSQ  CTGAATCCGTTCAAGCACATGAATCGAATAAAGATAAACAGGGAGGAAAAATGTTTACTAGGTAGCACTTCTTTTATTAAGATAGATAAGGTTAAACACATTCCCGGTAACGCCGTAAACGTTTCGAAATCTATACACGTGCGAGGACAGGACTTTACGTTATCAGAACTGTTGTATTCCCCGTTGTATTTTCAGCAGGCGCGTGGACAATGTATCATGCCTCATTTTGTATTAAAATGTATAGACGAGGCTAAAAAAAATAGGATGGTCTGTAAATATTGTACAGTAACTAAATCGAGCGACCCACAGGGTTTAAACGCAAACATTTTCATTCCGACAAAAACGGAATCGACATATATTATCATAGGCATACGTATAAAAAGTTATTGGTCCGTTACATTTCGAGTGGAG
TRN  10010101100011000
//