EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04582 - Reo_sigmaC)
FAM  PF04582
PID  Reo_sigmaC
DES  Reovirus sigma C capsid protein
IPR  IPR007662
ANO  4
ALN  326
AID  0.605287
APH  (Q9J1B6_9REOV/1-326:0.14149,Q9DPB5_9REOV/1-326:0.14643,(Q83931_9REOV/1-326:0.47492,Q9DPB4_9REOV/1-326:0.28019):0.24554);
ATP  (Q9J1B6_9REOV/1-326,Q9DPB5_9REOV/1-326,(Q83931_9REOV/1-326,Q9DPB4_9REOV/1-326));
ATL  1.28857
DNO  4
DLN  978
DID  0.609577
DPH  (Q9J1B6_9REOV/1-326:0.15229,Q9DPB5_9REOV/1-326:0.11876,(Q83931_9REOV/1-326:0.41802,Q9DPB4_9REOV/1-326:0.24607):0.22791);
DTP  (Q9J1B6_9REOV/1-326,Q9DPB5_9REOV/1-326,(Q83931_9REOV/1-326,Q9DPB4_9REOV/1-326));
DTL  1.16305
RID  0.605287
RPH  (Q9J1B6_9REOV/1-326:0.14149,Q9DPB5_9REOV/1-326:0.14643,(Q83931_9REOV/1-326:0.47492,Q9DPB4_9REOV/1-326:0.28019):0.24554);
RTP  (Q9J1B6_9REOV/1-326,Q9DPB5_9REOV/1-326,(Q83931_9REOV/1-326,Q9DPB4_9REOV/1-326));
RTL  1.28857
LNK  Q83931_9REOV/1-326:Q83931:L07069
LNK  Q9DPB4_9REOV/1-326:Q9DPB4:AF297214
LNK  Q9DPB5_9REOV/1-326:Q9DPB5:AF297213
LNK  Q9J1B6_9REOV/1-326:Q9J1B6:AF218358
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9J1B6_9REOV/1-326
ASQ  MAGLNPSQRREVVSLILSLTSNVTISHGDLTPIYERLTNLEASTELLHRSISDISTTVSNISANLQDMTHTLDDVTANLDGLRTTVTALQDSVSILSTNVTDLTNTSSAHAATLSSLQTTVDGNSTAISNLKSDVSSNGLAITDLQDRVKSLESTASHGLSFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAQLMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVTSNVVLLTFDLSDITHIPSDLARLVPSAGFQAASFPVDVSFTRDSATHAYQAYGVYSSSRVFTITFPTGGDGTANIRSLTVRTGIDT
DSQ  ATGGCGGGTCTCAATCCATCGCAGCGAAGAGAGGTCGTCAGCTTGATACTGTCATTGACTTCGAACGTGACTATAAGTCATGGCGATTTGACGCCGATCTATGAACGGCTGACCAATCTAGAAGCGTCTACGGAGTTATTACATCGCTCCATTTCCGATATATCCACTACTGTCTCAAATATTTCTGCAAATTTACAAGACATGACCCATACCTTGGATGATGTAACTGCTAATTTAGACGGTTTGAGGACCACTGTTACTGCACTTCAGGATTCCGTCTCCATTCTGTCTACAAATGTGACTGACTTAACGAACACATCCTCTGCGCACGCGGCGACACTATCTTCACTTCAAACTACGGTTGACGGAAACTCCACTGCCATCTCCAATTTGAAGAGTGATGTATCGTCGAACGGTTTAGCTATTACAGATCTGCAGGATCGTGTTAAATCATTGGAGTCTACCGCGAGTCATGGTCTATCTTTTTCGCCTCCGCTTAGTGTCGCTGACGGCGTGGTTTCATTAGACATGGACCCCTACTTCTGTTCTCAACGAGTTTCTTTAACATCATACTCGGCGGAGGCTCAACTAATGCAATTTCGGTGGATGGCACGGGGTACTAACGGATCATCTGATACCATTGACATGACCGTTAACGCTCACTGTCATGGAAGACGCACTGATTATATGATGTCGTCCACGGGAAATCTCACGGTCACTAGTAACGTCGTGTTATTAACCTTCGATTTAAGTGACATAACGCATATCCCATCAGACCTAGCACGTCTTGTTCCCAGTGCGGGATTCCAAGCTGCGTCGTTCCCTGTGGACGTATCATTCACCCGCGATTCTGCGACTCATGCGTACCAAGCGTATGGGGTGTACTCGAGCTCACGTGTCTTCACAATTACTTTCCCAACCGGAGGTGATGGTACAGCGAACATTCGTTCCTTGACCGTGCGTACCGGCATCGACACC
TRN  10010101100011000
NAM  Q9DPB5_9REOV/1-326
ASQ  MAGLNPLQRREVVSLILSLTSSTTTNPGDLTAVYERLTNLEASTKSLRQSLSSIVSDLSDVSVDLQDTTRALDDAIATLKGLNTTVAALQNSVASLSSTVNGLTDISSAHSEALSFLRTTIDGNTVAISNLKGDVSTNGLNIADLQNRMKSLESSTSHGLSFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAKLMQFQWMAKGTSGSSDVIDMTVNAHCHGRRTDYMMSSTGGLTVTSNAVSLTFSLDYITNMPSDLSRLIPSVGFQAASFPVDVSFTRDSATHSYQVYGAYSSARVFTITFPTGGNGTSNIRFLTVRTGIDT
DSQ  ATGGCGGGTCTCAATCCATTGCAGCGAAGAGAAGTCGTCAGCTTGATACTGTCATTGACTTCGAGCACGACTACAAATCCTGGCGATTTGACAGCAGTCTATGAGCGGTTGACCAATTTGGAGGCGTCTACGAAGTCATTGCGTCAATCCCTTTCCAGCATAGTCTCTGATTTGTCTGATGTTTCCGTTGATTTACAAGATACGACGCGTGCCTTAGACGACGCGATCGCTACTTTAAAAGGTCTGAATACCACTGTCGCTGCGCTCCAGAATTCTGTAGCCTCTCTATCCTCAACTGTGAATGGGCTAACAGATATTTCCTCCGCCCATTCGGAAGCGCTATCATTTCTGCGAACTACGATAGATGGGAACACAGTTGCGATTTCTAATTTGAAGGGTGACGTGTCGACTAATGGCTTAAATATTGCGGACCTCCAGAATCGCATGAAATCGTTAGAGTCCAGTACGAGTCATGGTTTATCGTTTTCACCTCCTCTTAGCGTTGCTGACGGCGTGGTGTCACTGGATATGGATCCTTACTTTTGTTCTCAACGCGTTTCGTTAACTTCATATTCAGCGGAGGCTAAACTGATGCAATTTCAGTGGATGGCGAAAGGCACTAGTGGTTCATCTGATGTCATCGATATGACTGTCAACGCTCACTGTCATGGGAGACGCACTGACTACATGATGTCATCTACTGGAGGCCTCACAGTCACTAGCAATGCCGTATCTTTGACCTTCAGCTTAGATTATATTACCAATATGCCTTCAGATTTATCACGTCTTATTCCCAGCGTAGGATTTCAAGCTGCATCGTTCCCTGTGGATGTGTCATTCACCAGAGATTCTGCGACTCATTCCTACCAAGTGTATGGAGCGTACTCAAGTGCGCGTGTCTTCACAATCACTTTCCCCACTGGTGGTAATGGTACATCGAACATTCGTTTCCTAACCGTGCGTACCGGCATCGACACT
TRN  10010101100011000
NAM  Q9DPB4_9REOV/1-326
ASQ  MAGLTPSQRREVVGLILSLTSSANTNCGDLTPVYDRLLSLESAVASLDGSVGVLSQKVSDLESDLQGVVSSLGQANSTLTELSKELRQLSSSVDNLMTSLSDLSTTVSGNQAAIAGIQTSVHANTTDISNLKSSVSAISLNITDLERRVGDIESGSGPNLRFVSPLSLSQGVVSLVMDPYFCSDNQALTSYSTDAQLMQFQWLARGEDGSSSSVDMLVNRHCHGRRTDYMMSTTESFTVTGNSVSLVFNLDYITKPPSDMSRLVPRAGFQAASFPVDVSFTRDTTTHAYQVYGAFSSPRVFKITFLTGGTGTANLRFLTVRTGIDT
DSQ  ATGGCCGGATTAACTCCCTCACAGCGAAGAGAAGTCGTGGGATTGATACTCTCCTTGACTTCGAGCGCGAATACAAACTGTGGAGATTTGACGCCTGTTTATGATCGCCTACTTAGTCTGGAGTCCGCCGTTGCGTCATTGGATGGTTCTGTTGGTGTCTTGTCACAGAAGGTATCAGATTTAGAATCCGACTTACAAGGCGTTGTTTCATCTCTAGGTCAGGCCAACTCAACGTTGACCGAGTTATCTAAGGAACTACGTCAGCTGAGCAGCTCTGTCGACAACCTCATGACGTCTCTTTCAGATCTATCGACCACTGTGTCCGGGAATCAGGCTGCGATAGCTGGTATACAAACTTCTGTTCATGCTAATACGACTGACATTAGCAACCTGAAAAGCAGCGTATCTGCTATTAGCTTAAATATCACTGATCTCGAGCGGCGTGTGGGAGACATTGAGTCAGGCTCAGGCCCCAATTTGAGATTTGTGTCGCCCCTGAGTTTGTCCCAGGGTGTAGTGTCGCTGGTTATGGATCCTTATTTTTGTTCGGACAATCAAGCGTTGACCTCATATTCTACAGACGCTCAGTTGATGCAATTCCAGTGGTTGGCTAGAGGTGAGGATGGTTCATCGAGCTCTGTTGACATGCTCGTTAATCGGCACTGTCATGGGCGTCGCACTGACTATATGATGTCCACTACGGAAAGTTTCACCGTCACAGGTAACTCGGTGTCATTGGTTTTCAATCTGGACTATATTACCAAACCGCCGTCTGACATGTCGCGTTTAGTACCACGTGCTGGGTTCCAGGCTGCTTCTTTTCCCGTGGACGTTTCTTTCACTCGTGACACAACAACCCATGCTTACCAGGTGTACGGCGCTTTTTCTAGTCCTCGTGTCTTTAAGATTACGTTCCTCACAGGTGGTACTGGGACTGCGAATCTCCGTTTCTTGACCGTGCGTACGGGCATCGACACT
TRN  10010101100011000
NAM  Q83931_9REOV/1-326
ASQ  MDGLTQQQRREVVGLILSLTSSVTINPGDLTQIRERLSALESANASLSESVNTALSRLTDLSAALGNMATSVAEMKVELNSLISDVQALRTSLDSSSSELASLSLLVHDHDSSISDLQKESHALSGDITNLNSSVSAQGLTISSLEQRVQALEGGSSTSLLFADPLKLEAGTVSLELDPYFCSVSRNLTSYSADAQLMQFQWSVKGEDGATNSIDMDVNAHCHGPRTDYLMSTKQSLTITASPATLVFELDRITKLPPDLSRLIPCHGFQQATFPVDISFQRDGVSHSYQVYGTYTSSRVFKITFSPGASGPAVIQFLTVRTGIDT
DSQ  ATGGACGGATTAACTCAACAGCAGCGAAGAGAAGTCGTGGGGTTGATACTGTCATTGACTTCGAGCGTGACTATAAATCCTGGCGATTTGACTCAAATCCGTGAGCGTCTCTCTGCTCTAGAATCTGCGAATGCATCGTTGAGCGAGTCCGTTAACACGGCTTTGTCTAGATTGACGGATTTGTCTGCGGCGCTTGGCAATATGGCGACGTCGGTAGCAGAGATGAAAGTAGAATTGAATTCGTTAATTTCTGATGTTCAGGCCTTACGCACTTCCTTGGATTCTTCCTCTTCGGAACTGGCGTCTTTATCCTTATTGGTGCATGATCATGATTCTTCGATTTCTGATCTACAAAAGGAAAGTCATGCGTTATCGGGTGATATAACTAACCTTAATTCCTCAGTGTCAGCGCAGGGGCTTACTATTTCTAGCCTCGAACAACGCGTCCAGGCGCTAGAAGGGGGTTCTAGTACGAGTCTCTTATTTGCTGATCCTCTCAAGTTAGAAGCTGGGACTGTGTCATTAGAACTGGACCCATATTTCTGCTCTGTAAGCCGTAACTTGACATCGTATTCCGCTGACGCCCAATTGATGCAATTCCAGTGGTCTGTGAAAGGGGAAGATGGTGCTACAAATTCTATTGATATGGATGTGAATGCTCATTGCCATGGGCCACGTACCGATTATCTCATGTCAACTAAGCAATCGTTGACTATCACGGCATCCCCCGCCACTCTCGTCTTCGAACTCGACAGGATTACGAAGCTTCCTCCTGATCTCTCACGTCTGATTCCATGTCACGGTTTCCAGCAAGCCACTTTCCCCGTTGACATCTCTTTTCAACGTGACGGCGTTTCTCACTCATACCAGGTCTATGGGACATACACATCCTCTCGCGTCTTCAAGATTACATTCTCGCCAGGCGCTTCAGGTCCCGCGGTGATTCAATTCCTGACCGTGCGTACGGGCATCGATACC
TRN  10010101100011000
//