EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04570 - DUF581)
FAM  PF04570
PID  DUF581
DES  Protein of unknown function (DUF581)
IPR  IPR007650
ANO  12
ALN  59
AID  0.441192
APH  ((((((Q9SL94_ARATH/252-309:0.54238,((Q9M1W8_ARATH/186-244:0.68302,Q9LJ91_ARATH/195-253:0.39603):0.14388,Q9LYE4_ARATH/256-314:0.52456):0.06942):0.12517,Q9FH22_ARATH/53-111:0.65098):0.12842,(Q9S7C1_ARATH/119-176:0.17113,Q9LMA6_ARATH/142-199:0.33515):0.26674):0.23945,(Q9LM43_ARATH/63-110:0.20505,Q9SGZ8_ARATH/74-132:0.43648):0.13516):0.15020,Q9LV75_ARATH/42-100:0.45049):0.41618,O23607_ARATH/46-104:0.27291,O80506_ARATH/1-59:0.27547);
ATP  ((((((Q9SL94_ARATH/252-309,((Q9M1W8_ARATH/186-244,Q9LJ91_ARATH/195-253),Q9LYE4_ARATH/256-314)),Q9FH22_ARATH/53-111),(Q9S7C1_ARATH/119-176,Q9LMA6_ARATH/142-199)),(Q9LM43_ARATH/63-110,Q9SGZ8_ARATH/74-132)),Q9LV75_ARATH/42-100),O23607_ARATH/46-104,O80506_ARATH/1-59);
ATL  6.6731
DNO  12
DLN  177
DID  0.512278
DPH  ((((O23607_ARATH/46-104:0.11098,O80506_ARATH/1-59:0.30240):0.21558,Q9FH22_ARATH/53-111:0.41622):0.08031,(((Q9M1W8_ARATH/186-244:0.41279,Q9LJ91_ARATH/195-253:0.26245):0.09328,(Q9LYE4_ARATH/256-314:0.28514,Q9SL94_ARATH/252-309:0.32223):0.13396):0.10763,(Q9LV75_ARATH/42-100:0.35470,(Q9LM43_ARATH/63-110:0.25320,Q9SGZ8_ARATH/74-132:0.22713):0.17400):0.12019):0.09798):0.19846,Q9S7C1_ARATH/119-176:0.16348,Q9LMA6_ARATH/142-199:0.18002);
DTP  ((((O23607_ARATH/46-104,O80506_ARATH/1-59),Q9FH22_ARATH/53-111),(((Q9M1W8_ARATH/186-244,Q9LJ91_ARATH/195-253),(Q9LYE4_ARATH/256-314,Q9SL94_ARATH/252-309)),(Q9LV75_ARATH/42-100,(Q9LM43_ARATH/63-110,Q9SGZ8_ARATH/74-132)))),Q9S7C1_ARATH/119-176,Q9LMA6_ARATH/142-199);
DTL  4.51213
RID  0.441192
RPH  ((((((Q9SL94_ARATH/252-309:0.54238,((Q9M1W8_ARATH/186-244:0.68302,Q9LJ91_ARATH/195-253:0.39603):0.14388,Q9LYE4_ARATH/256-314:0.52456):0.06942):0.12517,Q9FH22_ARATH/53-111:0.65098):0.12842,(Q9S7C1_ARATH/119-176:0.17113,Q9LMA6_ARATH/142-199:0.33515):0.26674):0.23945,(Q9LM43_ARATH/63-110:0.20505,Q9SGZ8_ARATH/74-132:0.43648):0.13516):0.15020,Q9LV75_ARATH/42-100:0.45049):0.41618,O23607_ARATH/46-104:0.27291,O80506_ARATH/1-59:0.27547);
RTP  ((((((Q9SL94_ARATH/252-309,((Q9M1W8_ARATH/186-244,Q9LJ91_ARATH/195-253),Q9LYE4_ARATH/256-314)),Q9FH22_ARATH/53-111),(Q9S7C1_ARATH/119-176,Q9LMA6_ARATH/142-199)),(Q9LM43_ARATH/63-110,Q9SGZ8_ARATH/74-132)),Q9LV75_ARATH/42-100),O23607_ARATH/46-104,O80506_ARATH/1-59);
RTL  6.6731
LNK  O23607_ARATH/46-104:O23607:Z97343
LNK  O80506_ARATH/1-59:O80506:AC003672
LNK  Q9FH22_ARATH/53-111:Q9FH22:AB023028
LNK  Q9LJ91_ARATH/195-253:Q9LJ91:AP000731
LNK  Q9LM43_ARATH/63-110:Q9LM43:AC069252
LNK  Q9LMA6_ARATH/142-199:Q9LMA6:AC069143
LNK  Q9LV75_ARATH/42-100:Q9LV75:AB019236
LNK  Q9LYE4_ARATH/256-314:Q9LYE4:AL163815
LNK  Q9M1W8_ARATH/186-244:Q9M1W8:AL138648
LNK  Q9S7C1_ARATH/119-176:Q9S7C1:AC013258
LNK  Q9SGZ8_ARATH/74-132:Q9SGZ8:AC009243
LNK  Q9SL94_ARATH/252-309:Q9SL94:AC006053
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FH22_ARATH/53-111
ASQ  TTDTTNLRRCYQDSGFLEHCFLCRRKLLPAKDIYMYKGDRAFCSVECRSKQMIMDEEES
DSQ  ACGACGGACACGACTAATCTCCGTCGTTGTTATCAAGATTCTGGATTTCTCGAACATTGTTTTCTCTGTAGACGAAAACTTCTTCCAGCGAAAGATATCTACATGTATAAAGGTGATAGAGCGTTTTGTAGCGTGGAGTGTAGATCGAAGCAGATGATTATGGACGAAGAAGAAAGC
TRN  10010101110011011
NAM  Q9LMA6_ARATH/142-199
ASQ  ESPAKERRVLRDCPDFLTSCCLCKKKL-QGKDIYMYKGDEGFCSKECRSLKIMEDSLKE
DSQ  GAGTCACCGGCGAAGGAGAGGCGGGTATTGAGAGATTGTCCAGATTTTCTAACTTCTTGTTGCTTGTGTAAGAAGAAACTT---CAAGGCAAAGACATTTACATGTACAAAGGAGATGAAGGATTTTGTAGTAAAGAGTGTAGATCGTTGAAGATAATGGAGGATAGTTTAAAAGAG
TRN  10010101110011000
NAM  Q9S7C1_ARATH/119-176
ASQ  EPPVIERQSVRGPTEFLSSCCLCKKKL-QGKDIYMYKGEMGFCSAECRSVQIMNDERQE
DSQ  GAACCACCGGTTATTGAAAGACAGAGTGTTAGGGGTCCAACAGAGTTTCTGAGTTCGTGTTGCTTGTGTAAGAAGAAACTT---CAAGGCAAAGACATATACATGTACAAAGGAGAGATGGGATTTTGTAGTGCCGAATGCAGATCAGTGCAAATAATGAATGACGAACGACAAGAG
TRN  10010101100011001
NAM  Q9SL94_ARATH/252-309
ASQ  EDNKEKFGSVFPSDNFLGICNFCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDEEDL
DSQ  GAAGATAATAAAGAGAAGTTTGGTTCTGTGTTCCCCTCCGATAACTTCCTCGGCATCTGCAACTTCTGCAACAAGAAACTCGGAGGTGGCGACGACATATATATGTATCGA---GAGAAGTCATTTTGCAGTGAAGAGTGTCGTTCAGAGGAGATGATGATAGATGAGGAGGATTTG
TRN  10010101110011001
NAM  Q9LYE4_ARATH/256-314
ASQ  PLDLTTPVDVLPPKDFLSFCYGCSKKLGMGEDIYMYSGYKAFCSSECRSKEIDLDEEME
DSQ  CCTCTCGACTTGACAACACCTGTTGATGTGTTACCTCCCAAAGACTTCTTGAGCTTCTGCTACGGCTGTAGCAAGAAGTTGGGTATGGGAGAAGATATATACATGTACAGTGGATACAAAGCGTTCTGCAGTAGTGAGTGCCGTTCAAAGGAGATAGATCTGGATGAGGAAATGGAG
TRN  10010101100011000
NAM  Q9LJ91_ARATH/195-253
ASQ  DPVNESDSDYSPPDSFLSCCCNCKKSLGPRDDIFMYRGDRAFCSSECRSIEMMMSEEND
DSQ  GACCCGGTTAATGAATCGGATTCGGATTATTCCCCACCCGACAGTTTTCTCAGTTGTTGCTGTAACTGTAAGAAGAGTCTTGGGCCTCGTGATGACATTTTCATGTACAGGGGAGATAGAGCTTTCTGTAGCAGTGAATGCAGGTCCATAGAGATGATGATGTCAGAGGAAAATGAT
TRN  10010101110011001
NAM  Q9SGZ8_ARATH/74-132
ASQ  GNLRRHSGDFSDAGHFLRSCALCERLLVPGRDIYMYRGDKAFCSSECRQEQMAQDERKE
DSQ  GGTAACCTGAGGAGACACTCAGGCGATTTCTCCGACGCTGGACATTTCTTGAGATCTTGCGCACTTTGTGAACGCCTTCTTGTTCCTGGCCGCGACATCTATATGTATAGGGGAGATAAGGCTTTTTGTAGCTCAGAGTGCAGGCAAGAGCAAATGGCACAAGATGAGAGGAAAGAG
TRN  10010101100011001
NAM  Q9LM43_ARATH/63-110
ASQ  PRGTQRRHSSDYSEDFLRSCSLCKRLLVHGRDIYMYR-----------QQQITVDERKE
DSQ  CCAAGAGGTACACAGAGAAGACACTCAAGTGATTATTCTGAAGATTTTCTAAGATCTTGCTCTCTTTGTAAACGTCTTCTTGTTCATGGCCGTGACATCTATATGTATAGG---------------------------------CAACAACAAATTACAGTGGACGAGAGGAAGGAG
TRN  10010101110011001
NAM  Q9LV75_ARATH/42-100
ASQ  HPHNPMVVMASNYDDFLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLDEKKA
DSQ  CACCCTCACAATCCGATGGTGGTGATGGCTAGTAACTACGATGATTTCTTGAAGACTTGTAGTCTCTGCAATCGAAGTCTCTGCCATCATCGTGACATTTACATGTATAGAGGGAACAACGCATTTTGTAGCTTAGAATGCAGGGAGAAGCAAATTAAGCTGGACGAGAAAAAAGCG
TRN  10010101100011010
NAM  O80506_ARATH/1-59
ASQ  MASYYSGFLGCEEPHFLESCSLCRKHLGLNSDIFMYRGDKAFCSNECREEQIESDEAKE
DSQ  ATGGCTTCGTATTACTCTGGTTTTTTGGGTTGTGAAGAGCCACACTTTTTGGAATCGTGTTCTCTTTGCCGGAAACACCTTGGTCTTAACTCCGATATCTTCATGTACAGAGGAGACAAGGCTTTTTGTAGCAACGAGTGTAGAGAAGAACAGATTGAATCTGATGAAGCTAAGGAG
TRN  10010101110011011
NAM  O23607_ARATH/46-104
ASQ  HHQFDNSYYGYGQPHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKE
DSQ  CATCATCAATTCGACAATAGCTATTACGGTTATGGACAGCCTCATTTCTTGGACTCTTGCTTCCTCTGCAAGAAACGTCTTGGTGATAACAGAGACATCTTCATGTACAGAGGAGACACACCGTTCTGTAGTGAAGAGTGTAGAGAAGAACAGATAGAAAGAGACGAAGCAAAAGAG
TRN  10010101110011011
NAM  Q9M1W8_ARATH/186-244
ASQ  VPLPQPAMETKSTESFLSRCFTCKKNLDQKQDIYIYRGEKGFCSSECRYQEMLLDQMET
DSQ  GTTCCTTTACCCCAACCAGCCATGGAGACCAAGAGCACCGAGAGTTTTCTAAGCCGTTGCTTCACCTGCAAGAAGAATCTTGACCAGAAACAGGACATCTACATATACAGGGGAGAGAAAGGTTTTTGCAGCAGCGAGTGCAGGTACCAGGAGATGCTTCTTGATCAAATGGAGACC
TRN  10010101110011010
//