EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04552 - Sigma54_DBD)
FAM  PF04552
PID  Sigma54_DBD
DES  Sigma-54, DNA binding domain
IPR  IPR007634
ANO  30
ALN  164
AID  0.444031
APH  ((((((((((((((RP541_RHIME/343-503:0.12901,(O69778_RHIET/312-472:0.16310,Q98AS6_RHILO/303-463:0.10438):0.06695):0.07415,Q98GS5_RHILO/338-498:0.09321):0.04701,RP54_AZOCA/341-501:0.13034):0.04384,RP54_CAUCR/330-491:0.17188):0.05145,RP55_BRAJA/353-513:0.16021):0.06423,Q59085_AZOBR/359-519:0.14479):0.07958,Q9F1E7_ACEDI/298-457:0.50934):0.23245,O54393_MYXXA/344-503:0.32233):0.11955,(RP54_ALCEU/333-492:0.29869,(RP54_THIFE/315-474:0.29048,((RP54_ACIGB/321-480:0.29889,RP54_AZOVI/341-500:0.12888):0.03784,(RP54_ECOLI/316-475:0.17351,Q9KP49_VIBCH/326-485:0.07758):0.05555):0.10241):0.08647):0.09674):0.10379,((RP54_BACSU/274-434:0.44226,Q9F0Q3_ENTFA/280-441:0.31465):0.16557,Q9K710_BACHD/282-443:0.39278):0.08246):0.09307,(O69080_PLALI/335-494:0.64455,((Q9RII3_RHOSH/270-426:0.64051,O66858_AQUAE/244-398:0.57306):0.15394,(RP54_RHOCA/263-421:0.52029,RP54_RHOSH/269-429:0.32625):0.30380):0.08221):0.10529):0.04956,(O51406_BORBU/263-415:0.78399,(Q9PPN1_CAMJE/254-410:0.32955,RP54_HELPJ/253-408:0.27505):0.34841):0.23639):0.11452,Q9PDH1_XYLFA/301-460:0.32202):0.54664,Q9PJD0_CHLMU/264-419:0.37612,Q9Z7D5_CHLPN/269-424:0.29851);
ATP  ((((((((((((((RP541_RHIME/343-503,(O69778_RHIET/312-472,Q98AS6_RHILO/303-463)),Q98GS5_RHILO/338-498),RP54_AZOCA/341-501),RP54_CAUCR/330-491),RP55_BRAJA/353-513),Q59085_AZOBR/359-519),Q9F1E7_ACEDI/298-457),O54393_MYXXA/344-503),(RP54_ALCEU/333-492,(RP54_THIFE/315-474,((RP54_ACIGB/321-480,RP54_AZOVI/341-500),(RP54_ECOLI/316-475,Q9KP49_VIBCH/326-485))))),((RP54_BACSU/274-434,Q9F0Q3_ENTFA/280-441),Q9K710_BACHD/282-443)),(O69080_PLALI/335-494,((Q9RII3_RHOSH/270-426,O66858_AQUAE/244-398),(RP54_RHOCA/263-421,RP54_RHOSH/269-429)))),(O51406_BORBU/263-415,(Q9PPN1_CAMJE/254-410,RP54_HELPJ/253-408))),Q9PDH1_XYLFA/301-460),Q9PJD0_CHLMU/264-419,Q9Z7D5_CHLPN/269-424);
ATL  13.0259
DNO  28
DLN  492
DID  0.491746
DPH  (((((((((((((((RP54_CAUCR/330-491:0.18859,RP54_AZOCA/341-501:0.15637):0.03467,(Q98GS5_RHILO/338-498:0.15777,(RP541_RHIME/343-503:0.11626,(O69778_RHIET/312-472:0.14910,Q98AS6_RHILO/303-463:0.09638):0.09930):0.05622):0.04737):0.03634,(RP55_BRAJA/353-513:0.16218,Q59085_AZOBR/359-519:0.19148):0.03801):0.08914,(Q9RII3_RHOSH/270-426:0.45393,Q9F1E7_ACEDI/298-457:0.27597):0.08932):0.08593,O54393_MYXXA/344-503:0.26992):0.07270,(RP54_RHOCA/263-421:0.53643,O69080_PLALI/335-494:0.41843):0.14843):0.09810,(RP54_ALCEU/333-492:0.29734,(RP54_THIFE/315-474:0.27658,((RP54_ECOLI/316-475:0.21458,Q9KP49_VIBCH/326-485:0.19098):0.08310,RP54_AZOVI/341-500:0.11090):0.10305):0.06695):0.04167):0.14304,Q9PDH1_XYLFA/301-460:0.39743):0.18718,RP54_BACSU/274-434:0.33019):0.10255,Q9K710_BACHD/282-443:0.35815):0.09659,Q9F0Q3_ENTFA/280-441:0.33496):0.10976,O66858_AQUAE/244-398:0.45116):0.10549,(Q9PJD0_CHLMU/264-419:0.34964,Q9Z7D5_CHLPN/269-424:0.22990):0.37418):0.09545,O51406_BORBU/263-415:0.46302):0.17604,Q9PPN1_CAMJE/254-410:0.22171,RP54_HELPJ/253-408:0.29479);
DTP  (((((((((((((((RP54_CAUCR/330-491,RP54_AZOCA/341-501),(Q98GS5_RHILO/338-498,(RP541_RHIME/343-503,(O69778_RHIET/312-472,Q98AS6_RHILO/303-463)))),(RP55_BRAJA/353-513,Q59085_AZOBR/359-519)),(Q9RII3_RHOSH/270-426,Q9F1E7_ACEDI/298-457)),O54393_MYXXA/344-503),(RP54_RHOCA/263-421,O69080_PLALI/335-494)),(RP54_ALCEU/333-492,(RP54_THIFE/315-474,((RP54_ECOLI/316-475,Q9KP49_VIBCH/326-485),RP54_AZOVI/341-500)))),Q9PDH1_XYLFA/301-460),RP54_BACSU/274-434),Q9K710_BACHD/282-443),Q9F0Q3_ENTFA/280-441),O66858_AQUAE/244-398),(Q9PJD0_CHLMU/264-419,Q9Z7D5_CHLPN/269-424)),O51406_BORBU/263-415),Q9PPN1_CAMJE/254-410,RP54_HELPJ/253-408);
DTL  10.2747
RID  0.444097
RPH  ((((((((((((((RP541_RHIME/343-503:0.12913,(O69778_RHIET/312-472:0.16316,Q98AS6_RHILO/303-463:0.10465):0.06696):0.07377,Q98GS5_RHILO/338-498:0.09378):0.04721,RP54_AZOCA/341-501:0.13031):0.04420,RP54_CAUCR/330-491:0.17181):0.05195,RP55_BRAJA/353-513:0.16003):0.06392,Q59085_AZOBR/359-519:0.14444):0.08816,Q9F1E7_ACEDI/298-457:0.50194):0.23291,O54393_MYXXA/344-503:0.31648):0.12326,(RP54_ALCEU/333-492:0.29092,(RP54_THIFE/315-474:0.29439,((RP54_ECOLI/316-475:0.17929,Q9KP49_VIBCH/326-485:0.06763):0.06919,RP54_AZOVI/341-500:0.14071):0.11662):0.07163):0.10401):0.10648,((RP54_BACSU/274-434:0.44339,Q9F0Q3_ENTFA/280-441:0.31437):0.17324,Q9K710_BACHD/282-443:0.38945):0.07445):0.10079,(((Q9RII3_RHOSH/270-426:0.64340,RP54_RHOCA/263-421:0.66632):0.15857,O69080_PLALI/335-494:0.56742):0.17336,O66858_AQUAE/244-398:0.68972):0.02908):0.05833,(O51406_BORBU/263-415:0.76255,(Q9PPN1_CAMJE/254-410:0.33872,RP54_HELPJ/253-408:0.26596):0.36521):0.22628):0.11333,Q9PDH1_XYLFA/301-460:0.32298):0.55233,Q9PJD0_CHLMU/264-419:0.37234,Q9Z7D5_CHLPN/269-424:0.30171);
RTP  ((((((((((((((RP541_RHIME/343-503,(O69778_RHIET/312-472,Q98AS6_RHILO/303-463)),Q98GS5_RHILO/338-498),RP54_AZOCA/341-501),RP54_CAUCR/330-491),RP55_BRAJA/353-513),Q59085_AZOBR/359-519),Q9F1E7_ACEDI/298-457),O54393_MYXXA/344-503),(RP54_ALCEU/333-492,(RP54_THIFE/315-474,((RP54_ECOLI/316-475,Q9KP49_VIBCH/326-485),RP54_AZOVI/341-500)))),((RP54_BACSU/274-434,Q9F0Q3_ENTFA/280-441),Q9K710_BACHD/282-443)),(((Q9RII3_RHOSH/270-426,RP54_RHOCA/263-421),O69080_PLALI/335-494),O66858_AQUAE/244-398)),(O51406_BORBU/263-415,(Q9PPN1_CAMJE/254-410,RP54_HELPJ/253-408))),Q9PDH1_XYLFA/301-460),Q9PJD0_CHLMU/264-419,Q9Z7D5_CHLPN/269-424);
RTL  12.279
LNK  O51406_BORBU/263-415:O51406:AE001150
LNK  O54393_MYXXA/344-503:O54393:U81516
LNK  O66858_AQUAE/244-398:O66858:AE000697
LNK  O69080_PLALI/335-494:O69080:AF061965
LNK  O69778_RHIET/312-472:O69778:AJ005696
LNK  Q59085_AZOBR/359-519:Q59085:X84991
LNK  Q98AS6_RHILO/303-463:Q98AS6:BA000012
LNK  Q98GS5_RHILO/338-498:Q98GS5:BA000012
LNK  Q9F0Q3_ENTFA/280-441:Q9F0Q3:AF210458
LNK  Q9F1E7_ACEDI/298-457:Q9F1E7:AF030414
LNK  Q9K710_BACHD/282-443:Q9K710:BA000004
LNK  Q9KP49_VIBCH/326-485:Q9KP49:AE004322
LNK  Q9PDH1_XYLFA/301-460:Q9PDH1:AE003972
LNK  Q9PJD0_CHLMU/264-419:Q9PJD0:AE002356
LNK  Q9PPN1_CAMJE/254-410:Q9PPN1:AL139076
LNK  Q9RII3_RHOSH/270-426:Q9RII3:U78717
LNK  Q9Z7D5_CHLPN/269-424:Q9Z7D5:AE001658
LNK  RP541_RHIME/343-503:P17263:M16513
LNK  RP54_ACIGB/321-480:P33983:
LNK  RP54_ALCEU/333-492:P28615:X66793
LNK  RP54_AZOCA/341-501:P33984:X69959
LNK  RP54_AZOVI/341-500:P08623:X05888
LNK  RP54_BACSU/274-434:P24219:M73443
LNK  RP54_CAUCR/330-491:Q03408:X68549
LNK  RP54_ECOLI/316-475:P24255:M57612
LNK  RP54_HELPJ/253-408:Q9ZLC8:AE001497
LNK  RP54_RHOCA/263-421:P09433:X12358
LNK  RP54_RHOSH/269-429:Q01194:
LNK  RP54_THIFE/315-474:P24695:M58480
LNK  RP55_BRAJA/353-513:P30333:M59243
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O54393_MYXXA/344-503
ASQ  KDFIQDKLRSAMWLIRSIHQRQRTIYKVTESIVKFQRDFLDKGIAYLKPLILRDVAEDIGMHESTVSRVTTSKYVHTPQGIFELKYFFNSSI.ARVSGED-TASEAVKHHIKQLVAQED.ARNPYSDQKIVELLRSQG.TEIARRTVAKYREVLGILPSSKRKR
DSQ  AAGGACTTCATCCAGGACAAGCTGCGCAGCGCGATGTGGCTCATCCGCTCCATCCACCAGCGGCAGCGGACCATCTACAAAGTCACCGAGAGCATCGTGAAGTTCCAGCGGGACTTCCTGGACAAGGGCATTGCCTACCTCAAGCCGCTCATCCTCCGGGACGTGGCCGAGGACATCGGCATGCACGAGTCCACGGTGAGCCGCGTCACCACCAGCAAGTACGTGCACACACCGCAGGGCATCTTCGAGCTGAAGTACTTCTTCAACTCGTCCATC...GCCCGCGTCTCCGGTGAGGAC---ACCGCGAGCGAGGCGGTGAAGCACCACATCAAGCAGTTGGTGGCGCAGGAAGAC...GCCCGCAACCCGTACTCGGACCAGAAAATCGTCGAGCTGCTGCGCTCGCAGGGC...ACCGAGATTGCCCGCCGCACGGTGGCCAAGTACCGCGAGGTGCTGGGCATCCTCCCCAGCAGCAAGCGCAAGCGG
TRN  11011101101011011
NAM  Q98AS6_RHILO/303-463
ASQ  QSFLNECLQNANWLIRSLDQRAKTILKVAAEIIRQQDAFFEHGVAHLRPLNLRTVADAINVHQSTVSRVTSNKYMLTPRGVFELKYFFTVAI.GSSEGGDAYSAEAVRHQIKAMVAVES.PNEVLSDDDIATRLKETG.IDIARRTVAKYREALNIPSSARRRR
DSQ  CAGTCATTTCTCAACGAATGCCTCCAAAACGCGAACTGGCTAATCCGCAGCCTTGATCAGCGCGCCAAGACGATCCTCAAGGTAGCGGCTGAAATCATCCGCCAGCAGGACGCCTTTTTTGAACATGGGGTCGCCCACCTGCGGCCTCTCAATCTCAGGACTGTCGCGGATGCGATCAACGTGCACCAGTCGACGGTAAGCCGGGTAACGTCGAACAAGTACATGCTGACCCCGCGCGGCGTGTTCGAACTGAAGTATTTTTTCACTGTCGCGATC...GGCTCCTCCGAAGGCGGCGACGCGTACTCCGCCGAAGCTGTCCGCCATCAAATCAAGGCGATGGTTGCCGTGGAATCG...CCCAACGAAGTGCTTTCAGACGACGACATTGCCACCCGGCTCAAGGAAACCGGG...ATCGACATTGCTCGCCGCACCGTTGCGAAATATCGTGAGGCGCTGAACATCCCGTCCTCCGCGCGACGTCGCCGG
TRN  10010101100011001
NAM  O69778_RHIET/312-472
ASQ  QSFLNECFQSASWLVRSLDQRATTILKVATEIVRHQDVFLEDGIAHLRPLNLKTIADAIDMHESTVSRVTSNKYILTPRGVFELKYFFTVAI.PSSQGGDAHSAEAVRHQIRALIAAET.LHDVLSDDGIVAKLKETG.VDIARRTVAKYREAMRIPSSTQRRR
DSQ  CAGTCATTCCTCAACGAATGCTTCCAGAGCGCGAGCTGGTTGGTTCGGAGTCTCGATCAGCGCGCCACGACGATCCTTAAGGTGGCGACCGAAATCGTGCGCCACCAGGATGTCTTTTTGGAAGATGGCATTGCTCATCTTCGCCCTCTCAATCTTAAGACCATCGCTGACGCGATCGACATGCACGAGTCCACTGTAAGTCGGGTAACGTCGAACAAATACATTCTCACGCCCCGCGGCGTGTTCGAGCTCAAGTATTTTTTCACCGTCGCGATC...CCGTCCTCACAAGGCGGTGACGCGCACTCGGCCGAAGCTGTGCGCCATCAGATAAGGGCACTTATTGCCGCAGAGACG...CTCCATGATGTGCTGTCCGACGATGGCATCGTTGCCAAGCTCAAGGAAACAGGC...GTCGACATTGCTCGCCGCACAGTCGCCAAATATCGCGAGGCGATGAGGATCCCCTCGTCCACGCAACGGCGGCGG
TRN  10010101100011001
NAM  RP541_RHIME/343-503
ASQ  QAFLNECLQNANWLTRSLDQRARTIMKVASEIVRQQDAFLIHGVGHLRPLNLRIVADAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSI.GSAENGDAHSAESVRHRIRTMINQES.ADAVLSDDDIVDVLKQAG.VDIARRTVAKYREAMSIPSSVQRRR
DSQ  CAGGCCTTTCTCAACGAGTGCCTGCAGAATGCCAACTGGCTGACGCGCAGCCTCGATCAGCGCGCCAGGACGATCATGAAGGTGGCGAGCGAAATCGTCCGGCAGCAGGACGCCTTCCTCATCCACGGCGTCGGCCACCTGCGCCCGCTGAACCTCAGGATCGTCGCGGACGCGATCAAGATGCACGAGTCGACGGTGAGCCGGGTCACCTCCAACAAATACATGCTGACCCCGCGCGGGCTCTTCGAATTGAAATATTTCTTCACGGTCTCGATC...GGCTCGGCGGAAAACGGCGATGCACATTCGGCCGAGTCCGTGCGCCATCGCATCCGCACGATGATCAATCAGGAAAGC...GCCGATGCCGTGCTCTCGGACGACGACATCGTCGACGTCCTCAAGCAGGCCGGC...GTCGATATCGCCAGACGCACCGTCGCAAAATATCGCGAGGCGATGAGCATCCCCTCCTCCGTCCAGCGCCGCCGC
TRN  10010101100011011
NAM  Q98GS5_RHILO/338-498
ASQ  KDFLAECLQNANWLTRSLDQRAKTILKVASEIVRQQDAFLVHGVRQLKPLNLRTVADAIGMHESTVSRVTANKYMLTPRGVFELRYFFTASI.AASGGGDAHSSEAVRDRIKQLIDEEK.PVDVLSDDAIVDMLKESG.VDIARRTVAKYREGMNIPSSVQRRR
DSQ  AAGGATTTCCTGGCCGAATGCCTGCAGAACGCCAACTGGCTGACGCGAAGCCTCGACCAGCGGGCAAAGACGATCCTCAAAGTGGCCTCGGAAATCGTGCGCCAGCAGGATGCGTTCCTGGTCCATGGTGTGCGCCAGCTGAAGCCGCTCAATTTGCGCACGGTGGCCGACGCCATCGGCATGCACGAATCGACCGTCAGCCGCGTCACCGCCAACAAATACATGCTGACCCCGCGCGGCGTGTTCGAACTGCGCTATTTCTTCACCGCCTCGATC...GCCGCGTCGGGCGGCGGCGACGCGCATTCCTCGGAAGCGGTGCGTGACCGCATCAAGCAGCTGATCGACGAGGAGAAA...CCCGTCGATGTACTTTCGGATGACGCGATCGTCGACATGCTCAAGGAAAGCGGT...GTCGATATCGCCCGGCGCACGGTCGCCAAGTACCGGGAAGGCATGAATATTCCGTCGTCGGTGCAGCGCCGGCGC
TRN  11011101101011011
NAM  RP54_AZOCA/341-501
ASQ  KTFLADCLQSASWLTRSLDQRARTILKVASEIVRQQDAFLVHGVRHLRPLNLRTVADAIGMHESTVSRVTSNKYISTPRGVLEMKFFFSSSI.ASSGGGEAHAAEAVRHRIKSLIEAES.ADDVLSDDTLVQKLKDDG.IDIARRTVAKYRESMNIPSSVQRRR
DSQ  AAGACCTTCCTCGCCGACTGCCTCCAGAGCGCCTCCTGGCTTACCCGCTCGCTCGACCAGCGGGCTCGCACCATCCTCAAGGTGGCGAGCGAGATCGTGCGCCAGCAGGACGCCTTCCTCGTGCACGGCGTGCGGCACCTGCGCCCCCTGAACCTGCGCACGGTGGCGGATGCCATCGGCATGCACGAATCCACCGTCTCGCGGGTGACCTCGAACAAGTACATCTCCACCCCGCGCGGGGTGCTGGAGATGAAGTTCTTCTTCTCCTCCTCCATC...GCTTCCTCGGGTGGTGGCGAGGCCCATGCGGCGGAGGCGGTGCGCCACCGCATCAAGAGCCTCATCGAGGCCGAGAGT...GCGGACGACGTGCTGTCCGACGACACGCTGGTGCAGAAGCTGAAGGACGACGGC...ATCGATATCGCCCGCCGAACGGTCGCGAAATATCGCGAGAGCATGAACATCCCGTCCTCGGTCCAGCGCCGCCGC
TRN  11011101101011011
NAM  RP54_CAUCR/330-491
ASQ  KTFVADCMASANWLVKSLDQRAKTILKVASEIVRQQDGFLAFGVEHLRPLNLKTVADAIGMHESTVSRVTSNKYIATPRGVFELKFFFTSAI.QSSEGGEAHSAASVRHKIKGLVDAEKcEADVHSDDRIVEILKAAG.VDIARRTVAKYREAMRIPSSVERRR
DSQ  AAGACCTTCGTCGCCGACTGCATGGCCTCAGCCAACTGGCTGGTGAAGAGCCTGGACCAGCGGGCCAAGACCATCCTGAAGGTCGCCAGCGAGATCGTGCGCCAGCAGGACGGCTTCCTGGCCTTCGGCGTCGAGCACCTGCGACCGCTGAACTTGAAGACGGTCGCCGACGCCATCGGCATGCACGAGAGCACGGTCAGCCGCGTGACCTCGAACAAGTACATCGCCACCCCCCGCGGCGTGTTCGAGCTGAAGTTCTTCTTCACCTCGGCCATC...CAGTCGTCCGAAGGCGGCGAGGCCCACTCGGCCGCCAGCGTCCGGCACAAGATCAAGGGGCTGGTCGACGCCGAGAAAtgcGAGGCCGACGTCCATTCCGACGATCGCATCGTAGAGATTCTCAAGGCGGCCGGG...GTCGACATCGCCCGTCGGACCGTGGCCAAGTATCGAGAGGCCATGCGGATCCCCTCGTCAGTGGAGCGTCGCCGG
TRN  11011101101011001
NAM  Q59085_AZOBR/359-519
ASQ  KEYITERFQSANWLVKSLHQRATTILKVASEIIRQQDAFFIHGVSHLKPLILRDIAEAIGMHESTVSRVTTNKFMATPRGVFELKYFFTSAI.QGADGQAAHSAEAVRYRIKAMIDAEK.PDDVLSDDKIVEILRGEG.IDIARRTVAKYREAMRIPSSVQRRR
DSQ  AAGGAATACATCACCGAGCGCTTCCAATCGGCCAACTGGCTGGTCAAGTCGCTGCACCAGCGCGCCACCACGATTTTGAAGGTGGCCAGCGAGATCATCCGGCAGCAGGACGCCTTTTTCATCCACGGCGTCTCGCATTTGAAGCCGCTGATCCTGCGCGACATCGCCGAGGCGATCGGCATGCACGAGAGCACGGTCAGCCGTGTCACAACCAACAAGTTCATGGCGACGCCGCGCGGCGTGTTCGAGCTGAAATATTTCTTCACCTCCGCCATC...CAGGGGGCCGACGGGCAGGCCGCCCACTCGGCGGAGGCCGTGCGCTACCGCATCAAGGCGATGATCGACGCCGAGAAG...CCGGACGACGTGTTGTCGGACGATAAAATCGTCGAAATCCTTCGTGGTGAAGGG...ATCGACATTGCGCGCCGGACGGTCGCGAAGTATCGTGAAGCGATGCGCATTCCGTCATCGGTGCAGCGACGCCGT
TRN  11011101101011001
NAM  RP55_BRAJA/353-513
ASQ  KSYFTDALQNATWLVRALDQRARTILKVATEIVRQQDGFFTHGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASI.ASADGGEAHSAEAVRHHIKQLIDSEA.PAAILSDDTIVERLRASG.IDIARRTVAKYREAMRIPSSVQRRR
DSQ  AAGTCCTATTTCACCGACGCGCTCCAGAACGCGACCTGGCTCGTTCGCGCGCTCGACCAGCGCGCCCGCACCATCCTGAAAGTTGCAACCGAGATCGTGCGCCAGCAGGACGGCTTCTTCACCCATGGCGTCGCGCATTTGCGGCCGCTGAACCTGAAGGCCGTCGCCGACGCCATCCAGATGCATGAATCCACGGTGTCGCGCGTCACTGCCAACAAATACATGGCGACCAACCGCGGCACGTTCGAGCTGAAATATTTCTTCACCGCCTCGATC...GCCTCGGCCGACGGCGGCGAGGCGCATTCGGCCGAAGCCGTGCGCCACCACATCAAGCAGCTGATCGATTCGGAAGCG...CCGGCCGCGATCCTGTCGGATGATACCATCGTGGAACGGTTACGCGCTTCGGGC...ATTGATATTGCCCGCCGCACGGTCGCGAAGTACCGCGAAGCCATGCGCATTCCTTCCTCGGTGCAACGTCGCCGC
TRN  11011101101011010
NAM  Q9F1E7_ACEDI/298-457
ASQ  RTYLNDTLTSANWLIRALQQRSMTILRVSTEILRRQEDFLQHGPQALQPLNLRTVAEALNIHESTVSRVTANKYVATPRGVLPLKFFFVAAM.TGNDGEI-RSNIAIQSVIRRMIQGER.PDAVLSDEAISLTLRRQG.IDIARRTVAKYREAMGFPNSLQRLQ
DSQ  CGGACATACCTGAATGACACTCTGACCAGCGCGAACTGGCTGATCCGCGCGCTGCAGCAGCGCAGCATGACCATCCTGCGCGTCTCGACCGAGATCCTGCGCCGGCAGGAGGACTTCCTGCAGCACGGTCCGCAGGCCCTGCAGCCGCTCAACCTCCGGACGGTCGCCGAGGCGCTGAACATTCACGAAAGCACGGTCAGCCGCGTGACGGCGAACAAGTACGTCGCGACCCCGCGCGGCGTGCTGCCGCTGAAATTCTTCTTCGTGGCGGCCATG...ACCGGAAATGACGGCGAAATC---CGCAGCAACATTGCGATCCAGAGCGTGATCCGCCGCATGATCCAGGGCGAACGC...CCCGATGCCGTCCTGTCCGACGAGGCGATTTCCCTGACCCTGCGCCGGCAGGGC...ATCGACATCGCACGCCGCACGGTCGCGAAATATCGCGAGGCGATGGGCTTTCCCAATTCCCTCCAGCGGCTTCAG
TRN  11011101101011011
NAM  RP54_ACIGB/321-480
ASQ  NQYLRNQMLEAKNFIKSVDERHKTLLKVASCIVQHQREFLEIGAEGMKPLVLRDVAEEVELHESTVSRVTTNKFLLTPRGLFELKYFFSSHV.GTTSGGE-ASSTAIRAKIKKLVADEN.PRKPLSDNTIANLLKEEG.IDVARRTVAKYRESLHIPSSSDRKV
NAM  RP54_AZOVI/341-500
ASQ  NTFMRNQLQEARWFIKSLQSRNETLMKVSTQIVEHQRGFLDYGEEAMKPLVLHDIAEAVGMHESTISRVTTQKYMHTPRGIYELKYFFSSHV.STAEGGE-CSSTAIRAIIKKLIAAEN.PKKPLSDSKIAGLLEEQG.IQVARRTVAKYRESLSIAPSSERKR
DSQ  AACACCTTCATGCGCAACCAACTGCAGGAGGCGCGCTGGTTCATCAAGAGCCTGCAAAGTCGCAACGAAACCCTGATGAAGGTTTCGACCCAAATCGTCGAGCACCAGCGCGGCTTTCTCGACTACGGCGAAGAGGCCATGAAACCGCTGGTGCTGCACGATATCGCCGAGGCTGTCGGCATGCACGAATCGACCATCTCCAGGGTCACCACCCAGAAATACATGCACACTCCACGCGGTATTTACGAGCTGAAGTACTTCTTTTCCAGTCACGTC...AGTACCGCCGAAGGCGGTGAG---TGCTCGTCCACGGCCATCCGCGCCATCATCAAGAAATTGATTGCGGCGGAAAAT...CCGAAAAAGCCATTGAGCGACAGCAAGATCGCTGGTTTACTGGAAGAACAAGGC...ATACAGGTGGCTCGCCGTACAGTTGCCAAATACCGGGAATCGCTCAGTATTGCGCCTTCCAGCGAACGCAAGCGG
TRN  10010101100011010
NAM  Q9KP49_VIBCH/326-485
ASQ  SNYIRTNLQEAKWLIKSLESRNETLLKVAKCIVEHQHDFFEYGEEAMKPMVLNDVAMAVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHV.STDNGGE-CSSTAIRALIKKLVAAEN.PAKPLSDSKIATLLADQG.IQVARRTIAKYRESLGIAPSSQRKR
DSQ  AGCAACTACATCCGTACCAATTTGCAAGAGGCAAAATGGCTGATCAAAAGTTTAGAAAGTAGAAACGAGACACTGCTCAAAGTTGCCAAGTGCATAGTTGAACACCAACACGATTTCTTCGAGTATGGAGAAGAGGCGATGAAGCCGATGGTGCTCAACGATGTGGCGATGGCGGTGGAAATGCATGAATCGACAATTTCGCGTGTCACCACGCAGAAATACATGCATACCCCGCGCGGCATTTTTGAGTTGAAGTACTTTTTCTCCAGCCACGTC...AGTACTGACAATGGCGGAGAG---TGCTCGTCCACTGCGATCAGGGCGCTGATCAAAAAACTGGTGGCGGCAGAGAAT...CCTGCCAAACCACTCAGTGACAGCAAGATCGCAACCCTACTCGCTGACCAAGGC...ATCCAAGTCGCGCGGCGAACCATCGCCAAATACCGTGAATCACTTGGCATCGCCCCATCAAGTCAGCGCAAACGC
TRN  10010101100011000
NAM  RP54_ECOLI/316-475
ASQ  SQFIRSNLQDAKWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELKYFFSSHV.NTEGGGE-ASSTAIRALVKKLIAAEN.PAKPLSDSKLTSLLSEQG.IMVARRTVAKYRESLSIPPSNQRKQ
DSQ  AGCCAGTTTATCCGCAGCAATCTGCAGGATGCCAAATGGTTGATCAAGAGTCTGGAAAGCCGTAACGATACACTACTGCGCGTGAGTCGCTGTATCGTTGAACAGCAGCAAGCCTTCTTTGAGCAAGGTGAAGAATATATGAAACCGATGGTACTGGCCGATATCGCCCAGGCTGTCGAAATGCATGAATCGACGATATCTCGCGTGACCACGCAAAAATACCTGCATAGTCCACGAGGCATTTTTGAACTGAAGTATTTCTTTTCCAGTCACGTC...AATACCGAGGGCGGCGGCGAA---GCTTCCTCCACGGCGATTCGTGCGCTGGTGAAGAAATTAATCGCGGCGGAAAAC...CCAGCGAAACCGTTGAGCGACAGCAAGTTAACCTCTTTGCTGTCGGAACAAGGT...ATCATGGTGGCACGCCGCACTGTTGCGAAGTACCGAGAGTCTTTATCCATTCCGCCGTCAAACCAGCGTAAACAA
TRN  10010101100011000
NAM  RP54_THIFE/315-474
ASQ  HKYIQDQLNEARWFIKSLQSRQDTILKVARAIVERQKDFFANGPESMRPMVLRHIADAVEMHESTVSRVTNQKYMITPRGLYEFKYFFSSHV.GTDSGGS-ASATAIRALLIKMTQAED.AQHPLSDAEIARVLADQG.IQIARRTVAKYREAANVPPASQRRR
DSQ  CATAAATACATCCAGGATCAGCTTAATGAAGCGCGCTGGTTTATCAAAAGCCTGCAAAGCCGCCAAGACACCATATTGAAGGTGGCGCGCGCCATTGTCGAACGGCAGAAGGATTTTTTTGCCAACGGGCCCGAATCCATGCGGCCCATGGTTCTGCGTCACATCGCCGATGCAGTGGAAATGCATGAGTCTACGGTGTCGCGGGTCACCAACCAGAAATACATGATCACACCCCGCGGCCTCTACGAGTTCAAATATTTTTTTTCCAGTCATGTC...GGTACCGACAGCGGGGGCTCT---GCGTCGGCCACTGCCATTCGCGCGTTGCTCATCAAGATGACGCAGGCGGAAGAC...GCACAACACCCCCTCAGCGACGCGGAAATTGCCCGGGTGCTGGCCGATCAGGGC...ATTCAGATCGCGCGGCGAACGGTGGCCAAGTACCGCGAAGCGGCCAATGTCCCACCGGCGAGCCAGCGCCGTCGT
TRN  10010101100011011
NAM  RP54_ALCEU/333-492
ASQ  TAGLQQKLQEARWLIKNIQQRFDKILRVSQAIVERQKNFFSHGEIAMRPLVLREIADTLGLHESTISRVTTNKYMATPMGTFELKYFFGSHV.STETGGA-ASSTAIRALIKQLIGAED.PRNPLSDSRIAELLGEQG.FVVARRTVAKYREALKIPAVNLRKS
DSQ  ACCGCCGGGCTGCAGCAGAAGCTGCAAGAGGCGCGCTGGCTGATCAAGAACATCCAGCAGAGGTTCGACAAAATCCTGCGTGTCTCGCAGGCCATTGTCGAGCGTCAAAAGAACTTTTTCAGCCACGGCGAAATCGCCATGCGCCCCTTGGTTTTGCGGGAGATTGCCGATACACTGGGTTTACACGAGTCAACCATCTCCCGGGTGACGACCAATAAATATATGGCAACGCCGATGGGTACTTTCGAACTGAAGTACTTCTTCGGCAGCCACGTG...TCCACCGAAACCGGTGGCGCG---GCTTCGTCAACGGCCATCCGCGCCTTGATCAAGCAACTGATAGGAGCCGAAGAC...CCGAGGAATCCCCTTTCCGACAGTCGCATTGCCGAACTGCTGGGCGAACAAGGC...TTCGTTGTCGCACGCCGCACCGTTGCCAAGTATCGCGAAGCCCTGAAGATCCCCGCAGTCAATCTCCGCAAGTCT
TRN  10010101100011000
NAM  Q9PDH1_XYLFA/301-460
ASQ  ASYLRNQLQEARWLLKGLEARGETLLKVVNSLIRHQTGFLEFGQHALRPLTIRELATELALHESTVSRAIAGKYVRTPRGTLPLRTFFASGI.STDSGGE-TSNSAIQAIIRRLIETEN.PRKPLSDAKLAELLKTSG.IPVARRTIAKYRDAMNISASHERVR
DSQ  GCGAGCTACCTACGCAACCAACTCCAGGAAGCACGGTGGCTGCTCAAGGGCCTGGAAGCACGCGGTGAAACCTTGTTAAAAGTGGTAAACAGCCTCATACGTCACCAAACGGGATTCTTGGAGTTCGGCCAACACGCGTTACGTCCATTGACGATCCGCGAATTAGCAACCGAACTTGCCCTGCATGAATCCACCGTATCCCGTGCAATTGCTGGCAAGTATGTACGCACCCCACGTGGCACCTTACCGCTACGCACCTTTTTCGCTTCAGGAATC...AGCACCGACAGCGGCGGAGAG---ACCTCCAACTCTGCCATTCAAGCAATCATCAGACGTCTCATAGAAACTGAAAAC...CCCCGCAAGCCACTCTCTGACGCCAAACTAGCTGAATTGCTGAAGACATCCGGT...ATCCCAGTAGCGCGACGCACCATAGCAAAGTATCGTGATGCTATGAACATCTCCGCATCCCACGAACGCGTCCGA
TRN  10010101100011000
NAM  Q9K710_BACHD/282-443
ASQ  AQYAKEKYHQMQWLVKSIQQRQQTLLKVTEAILRKQRAFFEEKEGALQPLTLREVAEEIGVHESTVSRATTNKYAQTPRGLLELKSFFVSSI.SSRFGEKGPSSDSVKKLVRKLVEEEN.KAKPLSDQKIAHLLKDQYnVEASRRVIAKYRDELGIPSSTKRKR
DSQ  GCGCAATATGCGAAGGAAAAGTACCATCAGATGCAATGGCTCGTGAAAAGCATTCAGCAGCGCCAGCAGACGCTTTTAAAGGTAACAGAAGCGATCTTGCGTAAGCAGCGAGCGTTCTTTGAAGAGAAAGAAGGTGCTCTTCAGCCGCTCACCTTGCGTGAGGTGGCAGAAGAAATTGGCGTCCATGAGTCTACGGTCAGCCGAGCAACGACCAATAAGTATGCGCAAACACCGCGAGGGCTTCTGGAATTAAAAAGCTTTTTCGTCTCGTCGATT...TCGAGTCGGTTTGGTGAAAAGGGGCCTTCTAGTGACTCAGTGAAGAAGCTTGTTCGAAAACTAGTTGAAGAGGAGAAC...AAAGCGAAGCCATTATCAGACCAAAAGATTGCCCATCTTTTAAAGGATCAATACaacGTTGAAGCTTCAAGACGAGTGATCGCAAAATACCGTGATGAGCTTGGGATCCCATCGTCCACAAAGCGAAAACGT
TRN  10010101100011000
NAM  Q9F0Q3_ENTFA/280-441
ASQ  QEYIKDKKNEFEWLERAVNQRGDTILRVGQEIVRRQEAFFLEADRPLKPMTLKEIADALSIHESTVSRAVNGKYLETTFGVFELRSFFSTSIlSSEEDGEDVSTTMVKKQLQKLIDQEV.KSKPLSDQKLVERLKDSG.MEISRRTVAKYREALGIPSSSKRKR
DSQ  CAAGAATATATTAAGGATAAGAAAAACGAATTTGAATGGTTAGAGCGTGCAGTGAATCAGCGGGGGGATACAATTTTACGTGTAGGGCAAGAAATTGTGCGCCGCCAAGAAGCCTTCTTTTTAGAAGCAGATCGGCCATTAAAACCAATGACTTTAAAAGAAATTGCGGATGCTTTGTCTATTCATGAATCGACAGTTAGTCGTGCGGTCAATGGAAAATATCTAGAAACCACGTTTGGCGTCTTTGAATTGCGCTCATTCTTCTCCACAAGTATTcttTCATCAGAAGAAGATGGCGAGGATGTCTCAACAACGATGGTTAAAAAGCAACTACAAAAATTAATTGATCAAGAAGTA...AAAAGTAAACCGTTATCTGATCAAAAATTAGTCGAGCGATTAAAAGATTCAGGC...ATGGAAATATCCCGACGAACGGTGGCAAAATATCGTGAAGCCCTAGGGATTCCATCTTCATCTAAACGAAAACGA
TRN  10010101110011000
NAM  RP54_BACSU/274-434
ASQ  VSYLSAKYQEWRWLSRALRQRKQTITRIINELITRQKDFFLKGRSAMKPLTLREVADCLSLHESTVSRAIKGKTIQTPYGLFEMKLFFSAKA.EASGDGD-ASNYAVKTHLENLINQED.KTKPLSDQKLVDLLYEQHgIQISRRTVAKYRDQMNIPSSAARKR
DSQ  GTCTCCTATTTATCTGCGAAATATCAGGAGTGGCGCTGGCTGAGCCGCGCGCTGCGGCAGCGAAAACAGACAATCACGAGAATTATCAATGAACTGATCACACGCCAAAAGGATTTCTTTCTGAAAGGGCGAAGCGCAATGAAGCCGCTGACTCTCAGAGAGGTGGCAGACTGTCTAAGCCTTCATGAATCAACTGTGAGCCGGGCCATTAAAGGGAAAACAATACAAACGCCTTACGGGCTGTTTGAGATGAAACTCTTTTTCTCAGCAAAAGCC...GAGGCTTCAGGTGATGGAGAT---GCGTCGAATTATGCAGTCAAAACGCATCTGGAAAACCTGATCAATCAAGAGGAC...AAAACAAAACCGCTTTCAGACCAAAAGCTTGTCGATTTGCTGTATGAACAACACggcATCCAAATCTCGAGACGCACCGTGGCAAAATATCGCGATCAAATGAATATTCCGTCATCGGCAGCGAGAAAGCGA
TRN  10010101100011000
NAM  O69080_PLALI/335-494
ASQ  REYIKRKVESAKWLIESIEQRHNTLKRVAQAIVDHQIEFLEKGPEFISPLKMQQIADIVKVHVTTVSRAVDDKWIQTPRGLFPLKRFFGGGT.TTAEGEE-VAWHIIRLKLKEIVDGEN.KDDPLSDDALVEELAKHG.FNLARRTVTKYRKALNIPSSRQRRS
DSQ  CGCGAATACATCAAACGCAAGGTGGAATCAGCCAAGTGGCTGATTGAATCGATCGAACAGCGACACAACACACTCAAGCGCGTGGCTCAGGCCATTGTTGATCATCAGATCGAATTCCTCGAAAAAGGCCCGGAGTTTATTTCGCCTCTCAAAATGCAGCAGATTGCGGATATCGTCAAAGTCCACGTCACGACCGTCTCGCGTGCTGTCGATGACAAGTGGATCCAGACACCACGGGGACTGTTTCCACTCAAAAGGTTCTTTGGAGGCGGTACG...ACAACGGCCGAAGGGGAAGAG---GTTGCCTGGCACATCATCCGCCTTAAACTCAAAGAGATTGTTGATGGTGAGAAC...AAAGATGACCCATTGAGCGATGATGCTCTGGTCGAAGAACTCGCCAAGCACGGC...TTCAACCTCGCCCGCCGCACGGTGACCAAGTACCGCAAAGCGCTGAACATACCTTCAAGCCGCCAGCGCCGCTCG
TRN  10010101100011001
NAM  O66858_AQUAE/244-398
ASQ  QKELKEAFERYESIRKVLDIRRRNLRKVLEKIVERQKDFLT-GKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGTYSLRTFFVRES.AEGLTQG----ELMK-LIKEIVENED.KRKPYSDQEIANILKEKG.FKVARRTVAKYREMLGIPSSRERRI
DSQ  CAAAAGGAACTAAAAGAGGCCTTTGAGAGGTACGAAAGTATAAGGAAGGTTCTGGATATAAGAAGAAGGAATTTAAGGAAAGTTTTAGAGAAAATCGTTGAAAGGCAAAAGGATTTTTTAACG---GGAAAGGGAAGTTTAAAACCGCTGACTTTGCGTGAAGTTTCAAGTGAGATAGGAATACACGAATCTACATTGAGCAGGATAGTGAACTCAAAGTACGTGAAAACTCCCGTGGGAACTTACTCCTTGAGAACTTTCTTTGTGAGAGAGTCG...GCGGAGGGATTAACGCAAGGT------------GAGTTAATGAAA---TTAATCAAGGAAATTGTAGAAAACGAAGAT...AAAAGGAAACCTTACAGTGACCAAGAAATAGCCAATATTCTAAAAGAGAAAGGC...TTTAAAGTTGCGAGGAGAACGGTTGCAAAATACAGGGAAATGTTAGGAATTCCCTCCTCAAGGGAAAGAAGGATT
TRN  10010101100011000
NAM  RP54_RHOSH/269-429
ASQ  DAWLARARSQARWLERAVERRQATLLRTAVCLVRHQADFLDQGPRALRPLSMEEVALELDLHPSTISRATATRLIETPRGLIPLRAFFSRSV.SSDGPEAPQSQDALMALVREIIARED.RTKPFSDDAIVKQAKLAG.AVLARRTVTKYRETLGIPSSYDRKR
NAM  RP54_RHOCA/263-421
ASQ  RAER-RRRGRGPGAGEALERRRDTLLRTAAVLVARQSAFLDKGPAHLVPLTLEDVASELGLHASTISRAVSGRMIQTQTRALPLRAFFSRAV.STQGGGEAVSRDSLDFVQRTWAAK-I.RQNPLSDDAIVTLAERAG.LRIARRTVAKYRSTLGLASSYERRR
DSQ  CGCGCGGAACGG---CGAAGGCGTGGCCGAGGCCCGGGCGCTGGCGAGGCGCTGGAGCGACGCCGCGATACGCTGTTGCGCACCGCCGCCGTGCTGGTGGCGCGGCAATCGGCCTTCCTCGACAAGGGGCCCGCCCATCTGGTGCCGCTGACGCTGGAGGATGTGGCCTCGGAACTGGGCCTGCATGCCTCGACGATTTCGCGCGCGGTCTCGGGGCGGATGATCCAGACCCAGACCCGGGCGCTGCCGCTGCGGGCGTTCTTTTCCCGCGCGGTC...TCGACCCAGGGCGGTGGCGAGGCGGTGTCGCGCGACAGCCTTGATTTCGTGCAGCGCACGTGGGCGGCGAAG---ATC...CGCCAAAACCCGCTGTCGGATGATGCGATCGTGACGCTCGCCGAACGCGCCGGG...CTGCGGATCGCGCGGCGGACGGTGGCGAAATACCGCTCGACGCTGGGCCTTGCCTCCTCCTACGAGCGTCGCCGC
TRN  10010101100011011
NAM  Q9RII3_RHOSH/270-426
ASQ  TPAARAAWTQAQAVGRMIENRNATLLRVAREILARQEAALDEGPSALVALTMTEVAEALGIHESTVSRVVAGTCVDTPRGTWWLRRMFSGRL.AEGGPSA----AAIRAAIARLVAQED.PAAPLSDGALVEALAAED.MQLARRTVAKYREMLNIPPGHRRRR
DSQ  ACGCCGGCCGCCCGCGCGGCCTGGACCCAGGCGCAGGCGGTGGGCCGGATGATCGAGAACCGCAATGCCACGCTGCTGAGGGTCGCGCGCGAGATCCTCGCCCGGCAGGAGGCGGCGCTCGACGAAGGTCCCTCGGCGCTCGTGGCCCTGACCATGACCGAGGTGGCCGAGGCGCTCGGCATCCACGAGAGCACGGTGAGCCGCGTGGTCGCGGGCACCTGCGTGGACACGCCGCGCGGCACCTGGTGGCTGCGGCGCATGTTCAGCGGCCGCCTT...GCCGAGGGCGGTCCCTCGGCC------------GCGGCCATCCGCGCCGCCATCGCCCGCCTCGTCGCGCAGGAAGAT...CCGGCCGCGCCTTTGTCCGACGGCGCTCTGGTCGAGGCGCTGGCGGCCGAGGAC...ATGCAGCTGGCGCGCCGCACCGTCGCCAAATATCGCGAGATGCTGAACATCCCCCCCGGACACCGCCGCCGCCGC
TRN  10010101100011011
NAM  RP54_HELPJ/253-408
ASQ  SDYLKEKLKEAKDLIDALNLRKATIYKIGLMLLEYQYDFFK--GKELRPLKLLDLANEFNHSVSTISRAISNKYLACERGVFPIKHFFSIAL.DNSETSN----AVIKDYLLELIKNED.KKEPLSDAKILELIEEKFhLKMVRRTITKYRQLLNIASSSERKR
DSQ  AGCGATTATTTAAAAGAAAAACTAAAAGAAGCCAAAGATTTGATTGACGCGTTAAATTTGAGAAAAGCCACGATTTATAAAATCGGTCTGATGCTCTTAGAATACCAATACGATTTTTTTAAA------GGTAAGGAATTACGCCCTTTAAAATTACTGGATTTAGCCAATGAGTTTAACCACTCTGTAAGCACGATTTCAAGGGCTATTTCTAATAAATATTTGGCATGCGAAAGGGGGGTTTTCCCCATTAAACATTTCTTTAGCATCGCCTTA...GACAATAGCGAGACTTCAAAC------------GCTGTGATTAAAGACTATCTTTTAGAATTGATTAAAAACGAGGAC...AAAAAAGAGCCTTTGAGCGACGCTAAGATTTTAGAACTCATTGAAGAGAAATTCcatTTGAAAATGGTAAGAAGAACGATCACCAAATACCGCCAACTGCTCAACATCGCTTCTTCAAGCGAAAGGAAAAGG
TRN  10010101100011000
NAM  Q9PPN1_CAMJE/254-410
ASQ  HDFLSHYIKEAKNLVDALAMRKATLYKIGLMIVEYQYDFFM--GKEIKPMTFKDLALDLERNASTISRAVANKYLSCERGLIPLRDFFAFAL.DEE--GE-TSNVGVKEFVANLVKNED.RNKPLSDSKILELIKEEFkVDIGRRTITKYRKHLNIASSTDRKK
DSQ  CATGATTTTTTAAGTCATTACATCAAAGAAGCAAAAAATTTAGTTGATGCTTTAGCGATGAGAAAAGCTACTCTTTATAAAATAGGGCTTATGATAGTAGAATATCAATATGATTTTTTCATG------GGAAAAGAGATAAAACCTATGACTTTTAAGGATTTAGCACTTGATTTAGAACGCAATGCTTCGACTATATCAAGAGCTGTGGCAAATAAATATTTAAGTTGTGAAAGAGGACTTATTCCCTTGCGTGATTTTTTTGCTTTTGCTCTT...GATGAAGAG------GGAGAG---ACTTCAAATGTAGGTGTTAAAGAATTTGTAGCAAATTTAGTAAAGAATGAAGAT...CGAAATAAACCTTTAAGCGATAGTAAAATTTTAGAATTAATCAAAGAAGAATTTaaaGTCGATATAGGGCGAAGAACTATTACAAAATATCGCAAACATCTTAATATAGCAAGTTCTACAGATAGAAAAAAA
TRN  10010101110011000
NAM  O51406_BORBU/263-415
ASQ  TSENPQKQKKAKWLIESLRYRDEILAKIGIAIYTLQKEFLRRGFKSLRPMNLSILSEKISVSKSTISRAIKNKYLKCEWGTILIKELFSS-V.GGAKTNE-FSKLSIKITVKKLLEA-N.KKM--SDKEISVILKSKG.ISISRRTVNKYRNELK---SEKGRT
DSQ  ACAAGTGAAAACCCCCAAAAACAAAAAAAAGCAAAGTGGTTAATCGAATCCCTACGATATAGAGACGAAATACTTGCAAAAATAGGAATAGCTATATATACATTGCAAAAAGAATTTCTAAGAAGAGGATTTAAAAGCTTAAGGCCAATGAACTTGAGCATTTTATCAGAAAAAATTAGTGTATCAAAATCAACAATATCAAGAGCAATAAAAAATAAATACTTAAAATGCGAATGGGGTACAATATTAATCAAAGAGCTTTTTAGCTCT---GTT...GGTGGAGCAAAAACAAATGAA---TTTTCAAAATTAAGCATCAAAATAACAGTAAAAAAGTTATTAGAAGCA---AAT...AAAAAGATG------TCAGACAAAGAGATTTCTGTTATACTAAAGTCCAAAGGA...ATCTCTATTTCTAGAAGAACAGTAAATAAATACAGAAATGAATTAAAA---------TCTGAGAAAGGGAGAACA
TRN  10010101110011000
NAM  Q9Z7D5_CHLPN/269-424
ASQ  QKNLSQQILSAKWLIKNLRKREQTLLQVMETLLPKQEDFLLGKIPAPYPLGIKDLAEDLSFHESTIFRAIENKAVAAPIGIFPLKHLFPRGI.HQDSSHS--KENVLQ-WIRQWIATE-.-QTPLSDSVISDRITAKG.IPCARRTVAKYRAQLKILPANKRKK
DSQ  CAGAAAAACCTCTCTCAACAAATTTTATCAGCAAAGTGGCTAATCAAAAATCTCAGAAAACGAGAACAAACGCTCCTTCAAGTGATGGAGACACTTCTCCCCAAACAAGAAGACTTTTTATTAGGAAAAATTCCAGCCCCCTATCCTTTAGGCATTAAAGATTTGGCTGAAGATCTCTCTTTTCATGAGTCAACAATCTTCCGTGCCATTGAAAACAAAGCGGTTGCAGCTCCTATAGGGATTTTCCCTCTAAAGCACCTCTTCCCCCGAGGAATC...CATCAAGATTCCTCGCATTCT------AAAGAGAATGTTCTACAA---TGGATCCGCCAATGGATCGCAACGGAA---...---CAAACTCCTCTATCTGATAGTGTGATCAGTGACAGAATCACTGCAAAAGGG...ATTCCTTGTGCCCGACGTACAGTAGCAAAATACCGTGCACAACTAAAGATCCTGCCTGCTAATAAAAGAAAAAAG
TRN  10010101100011000
NAM  Q9PJD0_CHLMU/264-419
ASQ  KDHLSQQIRAAKQLLRNIKKREETLLAVLRVLIPYQEEFLLKKRSVPKAFSVKQLARELSLHETTICRAINNKTLATPIGLISMRSLFPQAV.GACPDQS--KATILH-WIHQWISTE-.-KNPLSDEAISQKIIAKG.IPCARRTVAKYRSQLNIPPAHQRKH
DSQ  AAAGACCACTTATCACAACAAATTCGTGCTGCAAAACAGCTGCTTCGCAATATAAAAAAACGTGAAGAAACTTTATTAGCAGTCCTTCGCGTTTTAATTCCTTATCAGGAGGAATTCCTTCTTAAAAAACGTTCTGTTCCGAAAGCTTTTTCAGTAAAACAACTAGCTCGCGAACTCTCTCTTCATGAAACCACTATTTGTCGGGCAATCAATAATAAGACGCTCGCAACACCTATCGGATTGATTTCTATGCGGTCGCTATTTCCACAAGCTGTT...GGAGCTTGTCCTGATCAATCT------AAAGCTACTATTTTACAT---TGGATACATCAGTGGATATCTACAGAA---...---AAAAATCCTCTATCTGACGAGGCTATTAGCCAAAAAATTATTGCGAAAGGA...ATTCCTTGTGCACGCCGTACAGTAGCAAAATATCGGTCTCAACTAAACATCCCCCCAGCGCATCAGCGTAAACAT
TRN  10010101100011000
//