EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04549 - CD47)
FAM  PF04549
PID  CD47
DES  CD47 integrin associated protein
IPR  IPR006704
ANO  8
ALN  299
AID  0.353904
APH  ((((((O35294_RAT/8-295:0.23260,CD47_HUMAN/8-300:0.17608):0.06767,Q9GKE8_PIG/8-298:0.11513):0.11475,Q9D9W5_MOUSE/8-270:0.58207):0.53919,VA38_VARV/2-277:1.05698):0.74352,Q9DHI5_YLDV/7-260:0.78755):0.74883,Q9Q8V0_9POXV/10-276:0.15764,Q9Q8H3_9POXV/1-267:0.10991);
ATP  ((((((O35294_RAT/8-295,CD47_HUMAN/8-300),Q9GKE8_PIG/8-298),Q9D9W5_MOUSE/8-270),VA38_VARV/2-277),Q9DHI5_YLDV/7-260),Q9Q8V0_9POXV/10-276,Q9Q8H3_9POXV/1-267);
ATL  5.4319
DNO  8
DLN  897
DID  0.486985
DPH  ((((((CD47_HUMAN/8-300:0.09755,O35294_RAT/8-295:0.22683):0.03873,Q9GKE8_PIG/8-298:0.08204):0.09432,Q9D9W5_MOUSE/8-270:0.30078):0.39416,VA38_VARV/2-277:0.64786):0.32882,Q9DHI5_YLDV/7-260:0.51440):0.55836,Q9Q8V0_9POXV/10-276:0.12658,Q9Q8H3_9POXV/1-267:0.09948);
DTP  ((((((CD47_HUMAN/8-300,O35294_RAT/8-295),Q9GKE8_PIG/8-298),Q9D9W5_MOUSE/8-270),VA38_VARV/2-277),Q9DHI5_YLDV/7-260),Q9Q8V0_9POXV/10-276,Q9Q8H3_9POXV/1-267);
DTL  3.4737
RID  0.353904
RPH  ((((((O35294_RAT/8-295:0.23260,CD47_HUMAN/8-300:0.17608):0.06767,Q9GKE8_PIG/8-298:0.11513):0.11475,Q9D9W5_MOUSE/8-270:0.58207):0.53919,VA38_VARV/2-277:1.05698):0.74352,Q9DHI5_YLDV/7-260:0.78755):0.74883,Q9Q8V0_9POXV/10-276:0.15764,Q9Q8H3_9POXV/1-267:0.10991);
RTP  ((((((O35294_RAT/8-295,CD47_HUMAN/8-300),Q9GKE8_PIG/8-298),Q9D9W5_MOUSE/8-270),VA38_VARV/2-277),Q9DHI5_YLDV/7-260),Q9Q8V0_9POXV/10-276,Q9Q8H3_9POXV/1-267);
RTL  5.4319
LNK  CD47_HUMAN/8-300:Q08722:X69398
LNK  O35294_RAT/8-295:O35294:AF017437
LNK  Q9D9W5_MOUSE/8-270:Q9D9W5:AK006389
LNK  Q9DHI5_YLDV/7-260:Q9DHI5:AJ293568
LNK  Q9GKE8_PIG/8-298:Q9GKE8:AF270494
LNK  Q9Q8H3_9POXV/1-267:Q9Q8H3:AF170726
LNK  Q9Q8V0_9POXV/10-276:Q9Q8V0:AF170722
LNK  VA38_VARV/2-277:P33853:X69198
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O35294_RAT/8-295
ASQ  R----SCCCGSAQLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIYDGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAV..VGNYTCEVTELSREGKTVIELKNRPVSWFSTNEKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLALTLIVVVGA-ILFIPGEKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLAVVGMCLCIMAC-EPVHGPLLISGLGIIALAELLGLVYMKFV---ASNQRTIQ
DSQ  CGC------------TCCTGCTGCTGCGGTTCAGCTCAACTCCTGCTTAGTAAAGTCAAATCTGTAGAGTTCACGTCATGCAATGACACTGTGGTCATCCCTTGCAAAGTCCTTAATGTGGAGGCCCAAAGCACCGATGAAATGTTTGTGAAGTGGAAGTTGAACAAATCGTATATTTTCATCTATGATGGAAATAAAAATAGCACTACTAGAGAACAAAACTTTACCAGTGCAAAAATCTCGGTCTCAGACTTGCTCAAAGGCATTGCCTCTTTGACAATGGATACCCATGAGGCTGTG......GTGGGAAACTACACCTGTGAAGTGACTGAGCTTTCCAGAGAAGGCAAAACAGTTATAGAGCTGAAAAACCGCCCAGTTTCGTGGTTTTCTACAAATGAAAAGATCCTCATTGTTATTTTCCCAATTTTGGCTATACTCCTGTTCTGGGGAAAGTTTGGTATATTAACACTCAAATACAAGTCCAGCCATACGAATAAGAGAATCATTCTGCTGCTGGTTGCCGGGCTGGCACTCACACTCATCGTGGTTGTTGGCGCC---ATCCTTTTCATCCCGGGAGAGAAGCCCGTGAAGAACGCTTCTGGTCTTGGCCTCATTGTAATCTCCACAGGAATATTAATACTGCTTCAGTACAATGTGTTTATGACAGCTTTTGGAATGACCTCTTTCACCATTGCCATATTGATCACTCAAGTGCTGGGCTATGTCCTTGCTGTGGTCGGGATGTGTCTTTGCATCATGGCTTGT---GAACCAGTGCACGGCCCCCTTTTGATTTCAGGTTTGGGAATCATAGCTTTAGCAGAATTACTTGGACTAGTTTATATGAAGTTTGTC---------GCTTCCAACCAGCGAACTATACAA
TRN  10010101100011000
NAM  CD47_HUMAN/8-300
ASQ  LLLG-SACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVshTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGA-ILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAAC-IPMHGPLLISGLSILALAQLLGLVYMKFV---ASNQKTIQ
DSQ  CTGTTGCTGGGC---TCGGCGTGCTGCGGATCAGCTCAGCTACTATTTAATAAAACAAAATCTGTAGAATTCACGTTTTGTAATGACACTGTCGTCATTCCATGCTTTGTTACTAATATGGAGGCACAAAACACTACTGAAGTATACGTAAAGTGGAAATTTAAAGGAAGAGATATTTACACCTTTGATGGAGCTCTAAACAAGTCCACTGTCCCCACTGACTTTAGTAGTGCAAAAATTGAAGTCTCACAATTACTAAAAGGAGATGCCTCTTTGAAGATGGATAAGAGTGATGCTGTCtcacacACAGGAAACTACACTTGTGAAGTAACAGAATTAACCAGAGAAGGTGAAACGATCATCGAGCTAAAATATCGTGTTGTTTCATGGTTTTCTCCAAATGAAAATATTCTTATTGTTATTTTCCCAATTTTTGCTATACTCCTGTTCTGGGGACAGTTTGGTATTAAAACACTTAAATATAGATCCGGTGGTATGGATGAGAAAACAATTGCTTTACTTGTTGCTGGACTAGTGATCACTGTCATTGTCATTGTTGGAGCC---ATTCTTTTCGTCCCAGGTGAATATTCATTAAAGAATGCTACTGGCCTTGGTTTAATTGTGACTTCTACAGGGATATTAATATTACTTCACTACTATGTGTTTAGTACAGCGATTGGATTAACCTCCTTCGTCATTGCCATATTGGTTATTCAGGTGATAGCCTATATCCTCGCTGTGGTTGGACTGAGTCTCTGTATTGCGGCGTGT---ATACCAATGCATGGCCCTCTTCTGATTTCAGGTTTGAGTATCTTAGCTCTAGCACAATTACTTGGACTAGTTTATATGAAATTTGTG---------GCTTCCAATCAGAAGACTATACAA
TRN  10010101100011000
NAM  Q9GKE8_PIG/8-298
ASQ  VLLG-SAYCGSAQLIFNITKSVEFTVCNTTVTIPCFVNNMEAKNISELYVKWKFKGKDIFIFDGAQHISKPSEAFPSSKISPSELLHGIASLKMDKRDAV..IGNYTCEVTELSREGETIIELKRRFVSWFSPNENILIVIFPILAILLFWGQFGILTLKYKSSYTKEKTIFLLVAGLMLTIIVIVGA-ILFIPGEYSTKNACGLGLIVIPTAILILLQYCVFMMALGMSSFTIAILILQVLGHVLSVVGLSLCVSEC-TPVHGPLLISGLGIIALAELLGLVYMKCV---ASDHKTIQ
DSQ  GTGCTGCTGGGC---TCGGCGTACTGCGGTTCAGCTCAGTTGATATTTAATATAACCAAATCTGTAGAATTCACCGTTTGCAATACAACTGTTACCATCCCATGTTTTGTTAATAACATGGAGGCAAAGAACATTTCTGAATTGTATGTCAAGTGGAAATTTAAAGGAAAAGACATTTTCATCTTTGATGGCGCTCAGCACATATCCAAGCCCAGTGAAGCCTTCCCTAGTTCAAAAATCTCACCATCAGAATTACTACATGGCATTGCCTCTTTGAAGATGGATAAGCGTGATGCCGTC......ATAGGAAACTACACTTGTGAAGTAACAGAATTAAGCAGAGAAGGCGAAACCATCATAGAACTAAAACGTCGTTTTGTTTCATGGTTTTCTCCAAATGAAAATATCCTCATTGTTATTTTCCCAATTTTGGCTATACTTCTGTTCTGGGGACAGTTTGGTATTTTGACTCTTAAATATAAATCCAGTTATACGAAGGAGAAAACCATTTTTCTATTAGTTGCTGGACTAATGCTCACTATCATTGTCATTGTTGGAGCC---ATTCTTTTCATCCCAGGTGAATATTCAACAAAGAATGCTTGTGGACTTGGTTTAATTGTAATCCCTACAGCAATATTAATATTACTTCAATACTGTGTGTTTATGATGGCTCTTGGAATGTCTTCCTTCACCATTGCCATATTGATCCTTCAGGTATTGGGCCATGTGCTCTCTGTGGTTGGACTTAGCCTCTGCGTCTCAGAGTGT---ACCCCAGTGCATGGCCCTCTTCTGATTTCAGGTTTGGGTATTATAGCTCTAGCAGAATTACTTGGACTAGTTTATATGAAATGTGTT---------GCTTCTGATCACAAGACTATACAA
TRN  10010101100011000
NAM  Q9D9W5_MOUSE/8-270
ASQ  LLLG-SFHCGLAQLTFKNINSVKASNCSRIVLIPCYVSNIEAQDINELFLKWKFGQDIIFVFDGHANKSTT-YTFPSAQIFPSEFLKGNASLTLAKNEAR..AGNYTCEVTELSREGKHTVELKYSDGSWFTLSENIPIIIFPFLTVLLFWAQFGILMQKYKSNPVNRKILILSTSGLLFTIIVTVGA-ALYIP-------AIGRTL-----------------------QAVIMFTIAQGLGAVLTLAGLYLTASDC-VPKYGLLLISGLAIITLVELFGLIYMKWLDPMIGFHKTQK
DSQ  CTTCTTTTGGGT---TCTTTTCACTGTGGTTTGGCACAGCTAACCTTTAAAAATATTAACTCTGTAAAGGCTAGCAACTGCAGCAGAATTGTTCTTATTCCATGCTATGTCTCCAACATAGAGGCACAAGACATCAATGAATTATTTTTGAAGTGGAAATTTGGACAAGATATAATTTTTGTCTTTGATGGGCATGCAAACAAATCTACAACT---TATACGTTTCCAAGTGCACAAATTTTCCCCTCCGAATTTCTAAAAGGAAATGCATCTTTGACGTTGGCTAAGAATGAAGCTAGA......GCAGGAAACTACACATGTGAAGTGACAGAATTGAGCAGGGAGGGGAAACACACTGTGGAGCTAAAATATAGTGATGGTTCATGGTTTACTTTAAGTGAAAATATTCCCATTATTATTTTCCCATTTTTGACTGTACTTCTGTTCTGGGCACAGTTTGGTATTTTAATGCAAAAATATAAATCCAACCCTGTGAATAGGAAAATTCTTATTTTATCTACTTCTGGACTATTGTTCACCATAATTGTCACTGTTGGAGCC---GCCCTTTATATCCCA---------------------GCTATCGGGAGGACCCTC---------------------------------------------------------------------CAGGCTGTGATCATGTTCACCATTGCTCAAGGACTGGGTGCTGTACTCACTCTGGCGGGACTATATCTCACTGCATCTGACTGT---GTACCAAAATACGGCCTCCTTCTAATTTCAGGTTTGGCCATAATAACTCTAGTGGAATTATTTGGACTAATTTATATGAAATGGCTTGACCCAATGATAGGTTTCCATAAGACACAAAAG
TRN  10010101100011000
NAM  VA38_VARV/2-277
ASQ  LRVRILLIYLCTFVVITSTKTIEYTACNDTIIIPCTIDN------PTKYIRWKLDNHNILTYNKTSKTIILSKWHTSAKLH--SLSDNDVSLIIKYKDIL..PGTYTCED---NTGIKSTVKLVQRHTNWFNDHHTMLMFIFTGITLFLLFLEIAYTSISV---VFSTNLGILQVFGCIIAMIELCGAF-LFYPSMFTLRHIIGLLMMTLPSIFLIITKVFSFWLLCKLSCAVHLIIYYQLAGYILTVLGLGLSLKEC---VDGTLLLSGLGTIMVSEHFSLLFLVCF---PSTQRDYY
DSQ  TTAAGAGTTAGAATATTGTTGATATACCTCTGCACTTTTGTGGTTATAACATCTACAAAGACTATAGAGTATACGGCGTGCAATGATACCATCATTATTCCGTGTACTATAGATAAT------------------CCAACAAAGTATATTAGATGGAAATTGGACAACCATAATATTTTAACTTATAATAAAACTTCCAAGACGATCATATTAAGTAAATGGCATACTAGTGCCAAACTCCAT------TCGTTATCTGATAACGATGTTTCATTAATTATAAAGTATAAAGATATATTA......CCCGGTACTTATACATGCGAGGAT---------AACACCGGAATAAAATCTACTGTGAAATTAGTTCAACGTCATACTAATTGGTTTAATGACCATCATACAATGTTGATGTTTATTTTTACAGGCATTACTTTGTTCTTATTATTCCTCGAAATCGCTTATACATCGATATCAGTT---------GTATTTTCTACTAATTTAGGAATTTTACAAGTGTTTGGTTGTATTATTGCCATGATAGAGTTATGCGGGGCATTT---TTGTTTTATCCGTCAATGTTTACTCTCAGGCATATTATTGGATTGTTAATGATGACATTACCGTCTATATTTCTTATAATTACTAAAGTGTTTTCATTTTGGTTACTGTGTAAATTATCATGTGCTGTACACCTCATTATTTACTATCAATTGGCCGGATACATTTTAACGGTTTTGGGATTGGGATTGAGTCTAAAGGAATGT---------GTTGATGGAACTCTGTTATTATCTGGGTTGGGAACTATTATGGTGTCTGAACATTTTAGCCTGTTATTTCTAGTCTGCTTT---------CCATCAACGCAAAGAGACTATTAC
TRN  10010101100011000
NAM  Q9DHI5_YLDV/7-260
ASQ  MYMYNYIIICLFKLSLSTYIKVNYTTCNSSIYIVCS-SNLPYNSI----IEWKFNNKVIL--------------------------NNNNTLKFNFNNNL..SGNYTCKALNLFNK----IELQL-VINWITSEEKTVILYLLVTQLVVLW--ITILTLSLKINKFK-KVINLYATLIWVTILCLFIQYILRLNKKYSFIDIYGIMLISVLLFSSIGVNVLTLLKIKK-NKYLIVIIILKTVASILFFLVYLLILFYCYKNIFGLFLIYNLLIINIFELSYLVCLLII---PIELRIKY
DSQ  ATGTATATGTATAATTATATTATAATTTGTTTATTTAAATTAAGTTTGTCTACTTACATAAAAGTAAACTACACAACATGTAACAGTAGTATATATATTGTTTGCAGT---AGCAATTTACCTTATAATTCTATA------------ATAGAATGGAAATTTAACAACAAAGTTATATTA------------------------------------------------------------------------------AATAATAATAATACCCTAAAATTTAATTTTAACAATAACTTA......TCAGGAAATTATACGTGTAAAGCATTAAATCTTTTTAACAAA------------ATAGAGTTGCAATTA---GTAATAAACTGGATAACCTCAGAAGAAAAAACGGTTATTTTATATTTACTGGTTACTCAATTAGTTGTTTTGTGG------ATAACAATACTTACATTGTCACTTAAAATTAACAAGTTTAAA---AAAGTAATAAACCTATACGCAACACTAATATGGGTAACTATTTTATGTTTATTTATTCAATACATATTAAGACTTAATAAAAAATATTCTTTCATTGACATATACGGTATTATGTTAATATCTGTGTTACTTTTTTCATCAATTGGCGTTAATGTTTTAACTTTATTAAAAATTAAAAAA---AATAAATACCTTATAGTTATCATAATTTTGAAAACTGTTGCGTCTATACTATTTTTTTTAGTATATTTATTAATACTTTTTTATTGTTATAAAAATATTTTTGGATTATTTTTAATTTACAATTTATTAATTATAAACATATTTGAACTTTCATATTTAGTTTGTTTGCTTATAATA---------CCTATAGAATTAAGAATAAAGTAT
TRN  10010101100011000
NAM  Q9Q8H3_9POXV/1-267
ASQ  MIGLLFFVYVVPLAAENEVTVTPYTVCNKTVTLECNLDALIYKDINSVHVKWLFDTM----YDTISNKT------------------NGSSITFDFANNL..TGNYTCEAYSEFNSVKHVIALTF-VHQWFSREEIQFILSLLTIYIILLW--GNVCTITFKINNVS-KLIHVYSIALWMTLIMFVGQYMIGIDTDMLYVKVNGIILIQLSIFSSIFLQRILHKKLIP-SYLLNIVLGLKAVSYTGSTVVIALSFIGCYNKAYGYTYMYKLLFADILELISLIALYTL---PLGTQATY
DSQ  ATGATAGGTTTATTGTTCTTCGTATACGTAGTTCCTCTGGCCGCCGAAAACGAAGTAACCGTAACGCCCTACACGGTGTGTAATAAGACGGTTACGTTGGAGTGTAACCTAGACGCGTTAATTTACAAAGATATAAATTCTGTCCACGTAAAGTGGTTATTCGACACGATG------------TATGATACGATTTCGAATAAAACG------------------------------------------------------AACGGGTCGTCTATCACGTTCGATTTCGCGAACAACCTG......ACGGGGAACTACACGTGCGAGGCGTATAGCGAGTTCAACTCGGTGAAACACGTTATCGCGCTAACTTTC---GTACACCAATGGTTTAGTCGCGAAGAGATTCAGTTTATTCTGTCTTTACTTACTATTTACATTATATTGTTGTGG------GGAAACGTGTGTACGATAACGTTTAAAATAAACAACGTATCC---AAGTTGATTCACGTGTATTCTATCGCTTTATGGATGACGCTTATTATGTTCGTAGGACAGTATATGATCGGTATAGATACGGATATGTTATACGTAAAGGTAAACGGAATCATTCTTATTCAGCTGTCTATTTTCTCATCAATTTTCTTACAGCGTATTCTTCACAAAAAACTAATACCT---TCGTACTTACTAAATATCGTTTTGGGGTTGAAGGCCGTCTCGTATACGGGGTCTACGGTCGTTATCGCGTTATCCTTCATCGGATGTTACAATAAAGCGTACGGGTACACATACATGTATAAACTCTTGTTCGCGGATATATTAGAGTTAATTAGTTTAATCGCGTTGTACACGCTA---------CCCTTGGGCACTCAGGCGACGTAT
TRN  10010101100011000
NAM  Q9Q8V0_9POXV/10-276
ASQ  AHVGLLLVVFVHLTVGNKVTVMPYTVCNTTITLECNLDELIYKDINSIHVKWLF-----YTMDDTISNIT-----------------NGSFIKFDFAKNL..SGNYTCEAYSDLNSVKNVIALNL-VHQWFSREELQFILSLLTIYIILLW--CNVYTITSKTSNIS-KLIHVYSIALWMTIIMFVGQYMIGINTDMIYVKINGIILIQLSIISSVFLQRILHKTIIP-SYLLNIVMGLKVLSFTGSTIVIALSFVGCYNKAYGYTYVYKLLFADVLELISLITLYVL---PFGTQTTY
DSQ  GCGCATGTAGGTTTGTTATTAGTCGTATTCGTACACCTAACTGTGGGAAATAAAGTAACCGTTATGCCGTATACGGTGTGTAATACGACGATTACGTTGGAATGTAACTTAGACGAGTTAATTTACAAGGATATAAATTCCATCCACGTAAAGTGGTTATTC---------------TACACGATGGATGATACTATCTCGAATATAACG---------------------------------------------------AATGGATCATTTATCAAGTTTGACTTTGCTAAGAATCTG......TCGGGTAACTACACGTGCGAGGCGTATAGCGATTTAAACTCCGTAAAAAACGTTATTGCGTTGAATCTA---GTACACCAGTGGTTTAGTCGAGAGGAACTTCAGTTTATTTTATCGCTACTTACTATTTACATTATATTGTTATGG------TGTAATGTGTACACGATAACGTCTAAAACAAGCAATATATCC---AAGTTGATTCACGTATATTCTATCGCGTTGTGGATGACGATTATTATGTTCGTGGGACAGTATATGATTGGTATAAACACGGATATGATATACGTAAAAATAAACGGAATAATTCTCATTCAACTGTCTATTATCTCATCAGTTTTTTTACAACGTATTCTACACAAAACGATAATACCT---TCGTACTTACTAAATATAGTTATGGGGTTAAAGGTCTTATCGTTCACGGGGTCTACGATCGTTATCGCGTTATCCTTCGTCGGGTGTTATAATAAGGCATATGGGTACACTTATGTGTATAAACTATTGTTCGCGGATGTATTAGAATTAATTAGTTTAATCACATTATACGTACTA---------CCCTTTGGTACTCAGACAACGTAT
TRN  10010101100011000
//