EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04545 - Sigma70_r4)
FAM  PF04545
PID  Sigma70_r4
DES  Sigma-70, region 4
IPR  IPR007630
ANO  164
ALN  54
AID  0.300181
APH  (((((((((((((((((((((((((((P77841_CHLAU/245-298:0.33671,HRDC_STRCO/274-327:0.40824):0.15396,HRDD_STRCO/268-321:0.53012):0.20291,(((((O22058_ARATH/505-558:0.49062,(P77906_MYCTU/280-333:0.08369,Q79VF3_CORGL/266-319:0.18008):0.16770):0.08305,(HRDA_STRCO/331-384:0.18263,HRDB_STRCO/446-499:0.20125):0.09729):0.05708,((Q9ZPL1_MAIZE/457-510:0.25169,Q9ZPL2_MAIZE/469-522:0.13086):0.06429,O22056_ARATH/504-557:0.17680):0.24451):0.00000,(((Q39515_CYACA/524-577:0.15321,((RPOD_TREPA/545-598:0.18586,RPOD_BORBU/563-616:0.18691):0.18514,(Q39477_CYACA/543-596:0.31877,Q9ZTL1_CYACA/507-560:0.15151):0.17777):0.03262):0.07990,(((Q59302_CHLPS/489-542:0.23315,O08332_STAAU/303-356:0.08370):0.03267,O08348_XANCP/555-608:0.31470):0.03140,RPOD_SYNY3/360-413:0.13329):0.05490):0.03943,(((P71106_CHLAU/281-334:0.09785,P77840_CHLAU/278-331:0.22670):0.20285,P77842_CHLAU/331-384:0.07903):0.10964,(O67464_AQUAE/510-563:0.18555,Q9EZJ8_THEAQ/372-425:0.24345):0.08532):0.12239):0.02728):0.02995,P77996_THETU/196-248:0.65174):0.00000):0.10815,((((P96035_SYNSP/330-383:0.16587,(RPSC_ANASP/348-401:0.14062,Q9FD90_SYNEL/330-383:0.15680):0.06500):0.07298,(RPSC_SYNY3/336-389:0.21039,Q9R6V7_SYNP7/247-300:0.32279):0.06169):0.03233,(((((Q55525_SYNY3/280-333:0.12239,((RPSB_ANASP/268-321:0.36726,P96032_SYNSP/263-316:0.09035):0.07850,(Q55350_SYNSP/256-309:0.22205,Q9KHE5_ANASP/263-316:0.10472):0.05412):0.05437):0.11531,P96034_SYNSP/253-306:0.23544):0.10214,(P73666_SYNY3/254-307:0.09429,Q9KHE8_ANASP/268-321:0.15248):0.01888):0.02284,Q9R6V8_SYNP7/256-309:0.35975):0.18788,(Q9KI19_COXBU/285-338:0.31296,((O52607_RALSO/310-363:0.21037,Q9JP89_RHOGE/256-309:0.26425):0.19971,((O08372_ENTCL/278-331:0.16039,O33503_PSETO/269-322:0.11152):0.05247,Q9S4T1_LEGPN/275-328:0.27225):0.20634):0.07626):0.37957):0.06162):0.15294,(P73710_SYNY3/305-358:0.15485,P94906_MICAE/311-364:0.07268):0.31377):0.10407):0.07770,(Q9LD95_ARATH/479-532:0.46749,((Q9ZNX9_ARATH/452-505:0.63892,Q9ZSL6_ARATH/351-404:0.51197):0.05286,(O83976_TREPA/246-299:0.46824,P71149_CHLTE/233-286:0.37208):0.19212):0.08308):0.00000):0.22409,O67437_AQUAE/245-298:0.20306):0.10997,((Q9ZIL3_MYXXA/212-263:0.71837,(RPSB_MYXXA/177-228:0.18059,Q53611_STIAU/224-275:0.10515):0.31803):0.14786,((((O82849_PSEHY/248-299:0.16861,(Q9CKM7_PASMU/226-277:0.21897,(Q9KJX7_PSEPU/229-280:0.06917,Q9LAQ0_COXBU/232-283:0.22490):0.18537):0.27742):0.10970,Q9JVA9_NEIMA/229-281:0.19556):0.22490,(((P94333_BRAJA/239-290:0.41604,P77830_BRAJA/230-281:0.20351):0.07603,(P94330_BRAJA/230-281:0.06874,Q98FJ9_RHILO/230-281:0.15023):0.11274):0.09090,(((Q9ZDM4_RICPR/232-283:0.47541,RP32_ZYMMO/235-286:0.12922):0.05167,RP32_CAUCR/230-281:0.11074):0.05417,(O30806_RHOCA/233-284:0.15500,P95657_RHOSH/232-283:0.13293):0.08499):0.07549):0.19211):0.11471,(Q98FA7_RHILO/222-273:0.24572,Q9LA67_RHIME/223-274:0.20572):0.12237):0.15096):0.29673):0.24821,(((RPSE_CLOAB/176-229:0.12057,Q9K9T9_BACHD/178-231:0.16775):0.04744,((O32725_BACSH/197-246:0.34401,(RPSF_BACLI/199-248:0.00000,P70879_BACCO/199-248:0.26094):0.11571):0.38139,((((Q99SI8_STAAN/203-252:0.20550,(O85017_LISIN/202-251:0.12961,RPSB_BACAN/202-251:0.37064):0.07104):0.05755,Q9KFF0_BACHD/202-251:0.25279):0.12414,O50232_BACLI/204-253:0.05359):0.23727,((((((Q9K4K0_STRCO/222-271:0.27497,O86702_STRCO/207-256:0.00000):0.11855,O52313_STRCO/207-256:0.17883):0.31197,Q9ADM4_STRCO/264-313:0.11188):0.13975,Q9RIS5_STRCO/249-298:0.14391):0.21173,Q9ZIV9_9ACTO/288-337:0.34091):0.10009,Q9X7S2_STRCO/237-286:0.15512):0.32637):0.09731):0.08025):0.16053,Q9KDC8_BACHD/172-225:0.48930):0.13298):0.11492,(O25676_HELPY/199-248:0.44945,(((O84064_CHLTR/198-247:0.29141,((O34843_BACSU/132-181:0.75916,Q9X004_THEMA/162-211:0.21335):0.10696,Q97H70_CLOAB/184-233:0.38458):0.03886):0.06293,((((Q9Z5S6_ZYMMO/188-237:0.44398,Q9KQD4_VIBCH/186-235:0.09776):0.09324,FLIA_PSEAE/190-239:0.15042):0.00000,(FLIA_YEREN/175-224:0.21075,(Q9AES5_AERHY/181-230:0.52330,Q9L774_XANOR/186-235:0.04793):0.14117):0.04417):0.16897,(O83707_TREPA/203-252:0.31876,P77959_STRRP/222-271:0.22377):0.06201):0.05769):0.16111,O67268_AQUAE/181-230:0.40439):0.07247):0.11719):0.25716,Q9X6P9_LEPIN/119-168:0.85332):0.11635,(O07627_BACSU/113-162:0.27050,Q9HYV8_PSEAE/143-192:0.75717):0.36368):0.09529,((Q9L430_BORBR/119-168:0.29802,((Q9A9J9_CAUCR/124-173:0.46242,Q9I3Y1_PSEAE/188-237:0.35928):0.17660,Q9I444_PSEAE/118-167:0.34564):0.06683):0.12937,(Q9I6Y3_PSEAE/117-166:0.60141,(Q9I222_PSEAE/116-165:0.52434,Q9I646_PSEAE/116-165:0.58950):0.48731):0.11630):0.55283):0.04725,((((Q98BR7_RHILO/124-173:0.56837,Q9X8Z1_STRCO/115-163:0.68905):0.18173,Q9A3F1_CAUCR/123-172:0.84380):0.00000,(Q98L14_RHILO/130-179:0.57761,P74595_SYNY3/202-251:0.66953):0.21527):0.13666,O68887_STRAT/108-157:0.48206):0.15434):0.00000,((Q9AD34_STRCO/172-221:1.10933,Q9I2W5_PSEAE/108-157:0.85498):0.12459,Q9KBA2_BACHD/122-171:0.43265):0.18585):0.06512,(((Q55192_SYNY3/129-178:0.24469,(O53730_MYCTU/133-182:0.46450,Q9S2A7_STRCO/130-179:0.32385):0.35223):0.20837,((Q9A7S1_CAUCR/130-179:0.73226,(Q984A3_RHILO/162-211:0.39085,Q9RI52_STRCO/141-190:0.34879):0.19268):0.04295,(Q9K7Z1_BACHD/126-175:0.64434,Q9AAF3_CAUCR/146-195:0.35797):0.17034):0.01582):0.14968,Q9KPR4_VIBCH/138-187:0.59736):0.16481):0.00000,(SIGY_BACSU/124-173:0.62687,Q9KF66_BACHD/114-163:0.52078):0.31844):0.02796,((Q9L1Z6_STRCO/151-200:0.31354,(P73744_SYNY3/126-175:0.33717,Q9WWP4_SYNP2/141-190:0.10341):0.37541):0.08082,(O53798_MYCBO/119-168:0.44668,Q9L1U1_STRCO/136-185:0.54173):0.20133):0.25084):0.03870,(CARQ_MYXXA/114-163:0.67095,Q9RXX5_DEIRA/171-219:0.30834):0.37814):0.13334,((SIGV_BACSU/109-158:0.38874,Q9K7J9_BACHD/126-175:0.67841):0.26877,(Q9KCF6_BACHD/118-167:0.64142,O83130_TREPA/103-152:0.63204):0.00000):0.11197):0.00000,(Q97E49_CLOAB/131-180:0.40889,(SIGW_BACSU/133-182:0.18127,Q9KG50_BACHD/133-182:0.24256):0.22307):0.11129):0.01932,Q9R393_PSESX/129-178:0.97505):0.03342,Q98CJ9_RHILO/127-176:0.59847):0.09951,((((O86856_STRCO/135-183:0.64298,(Q9EXR8_BRAJA/106-155:0.22686,Q9KIN1_PSEFL/20-69:0.28777):0.11190):0.15820,Q9RKI2_STRCO/138-187:0.27618):0.19374,(O68520_MYXXA/129-178:0.26999,Q9XCD8_MYCSM/141-190:0.31570):0.16376):0.10523,Q9X1T4_THEMA/130-178:0.45280):0.03020):0.00000,(O85900_SPHAR/123-172:0.65895,Q983W6_RHILO/124-173:0.34223):0.12618):0.12232,O05735_MYCAV/186-235:0.41895):0.07485,P73431_SYNY3/166-215:0.38784):0.39202,Q9KPA6_VIBCH/135-184:0.00000,Q9RCH4_AZOVI/135-184:0.29927);
ATP  (((((((((((((((((((((((((((P77841_CHLAU/245-298,HRDC_STRCO/274-327),HRDD_STRCO/268-321),(((((O22058_ARATH/505-558,(P77906_MYCTU/280-333,Q79VF3_CORGL/266-319)),(HRDA_STRCO/331-384,HRDB_STRCO/446-499)),((Q9ZPL1_MAIZE/457-510,Q9ZPL2_MAIZE/469-522),O22056_ARATH/504-557)),(((Q39515_CYACA/524-577,((RPOD_TREPA/545-598,RPOD_BORBU/563-616),(Q39477_CYACA/543-596,Q9ZTL1_CYACA/507-560))),(((Q59302_CHLPS/489-542,O08332_STAAU/303-356),O08348_XANCP/555-608),RPOD_SYNY3/360-413)),(((P71106_CHLAU/281-334,P77840_CHLAU/278-331),P77842_CHLAU/331-384),(O67464_AQUAE/510-563,Q9EZJ8_THEAQ/372-425)))),P77996_THETU/196-248)),((((P96035_SYNSP/330-383,(RPSC_ANASP/348-401,Q9FD90_SYNEL/330-383)),(RPSC_SYNY3/336-389,Q9R6V7_SYNP7/247-300)),(((((Q55525_SYNY3/280-333,((RPSB_ANASP/268-321,P96032_SYNSP/263-316),(Q55350_SYNSP/256-309,Q9KHE5_ANASP/263-316))),P96034_SYNSP/253-306),(P73666_SYNY3/254-307,Q9KHE8_ANASP/268-321)),Q9R6V8_SYNP7/256-309),(Q9KI19_COXBU/285-338,((O52607_RALSO/310-363,Q9JP89_RHOGE/256-309),((O08372_ENTCL/278-331,O33503_PSETO/269-322),Q9S4T1_LEGPN/275-328))))),(P73710_SYNY3/305-358,P94906_MICAE/311-364))),(Q9LD95_ARATH/479-532,((Q9ZNX9_ARATH/452-505,Q9ZSL6_ARATH/351-404),(O83976_TREPA/246-299,P71149_CHLTE/233-286)))),O67437_AQUAE/245-298),((Q9ZIL3_MYXXA/212-263,(RPSB_MYXXA/177-228,Q53611_STIAU/224-275)),((((O82849_PSEHY/248-299,(Q9CKM7_PASMU/226-277,(Q9KJX7_PSEPU/229-280,Q9LAQ0_COXBU/232-283))),Q9JVA9_NEIMA/229-281),(((P94333_BRAJA/239-290,P77830_BRAJA/230-281),(P94330_BRAJA/230-281,Q98FJ9_RHILO/230-281)),(((Q9ZDM4_RICPR/232-283,RP32_ZYMMO/235-286),RP32_CAUCR/230-281),(O30806_RHOCA/233-284,P95657_RHOSH/232-283)))),(Q98FA7_RHILO/222-273,Q9LA67_RHIME/223-274)))),(((RPSE_CLOAB/176-229,Q9K9T9_BACHD/178-231),((O32725_BACSH/197-246,(RPSF_BACLI/199-248,P70879_BACCO/199-248)),((((Q99SI8_STAAN/203-252,(O85017_LISIN/202-251,RPSB_BACAN/202-251)),Q9KFF0_BACHD/202-251),O50232_BACLI/204-253),((((((Q9K4K0_STRCO/222-271,O86702_STRCO/207-256),O52313_STRCO/207-256),Q9ADM4_STRCO/264-313),Q9RIS5_STRCO/249-298),Q9ZIV9_9ACTO/288-337),Q9X7S2_STRCO/237-286)))),Q9KDC8_BACHD/172-225)),(O25676_HELPY/199-248,(((O84064_CHLTR/198-247,((O34843_BACSU/132-181,Q9X004_THEMA/162-211),Q97H70_CLOAB/184-233)),((((Q9Z5S6_ZYMMO/188-237,Q9KQD4_VIBCH/186-235),FLIA_PSEAE/190-239),(FLIA_YEREN/175-224,(Q9AES5_AERHY/181-230,Q9L774_XANOR/186-235))),(O83707_TREPA/203-252,P77959_STRRP/222-271))),O67268_AQUAE/181-230))),Q9X6P9_LEPIN/119-168),(O07627_BACSU/113-162,Q9HYV8_PSEAE/143-192)),((Q9L430_BORBR/119-168,((Q9A9J9_CAUCR/124-173,Q9I3Y1_PSEAE/188-237),Q9I444_PSEAE/118-167)),(Q9I6Y3_PSEAE/117-166,(Q9I222_PSEAE/116-165,Q9I646_PSEAE/116-165)))),((((Q98BR7_RHILO/124-173,Q9X8Z1_STRCO/115-163),Q9A3F1_CAUCR/123-172),(Q98L14_RHILO/130-179,P74595_SYNY3/202-251)),O68887_STRAT/108-157)),((Q9AD34_STRCO/172-221,Q9I2W5_PSEAE/108-157),Q9KBA2_BACHD/122-171)),(((Q55192_SYNY3/129-178,(O53730_MYCTU/133-182,Q9S2A7_STRCO/130-179)),((Q9A7S1_CAUCR/130-179,(Q984A3_RHILO/162-211,Q9RI52_STRCO/141-190)),(Q9K7Z1_BACHD/126-175,Q9AAF3_CAUCR/146-195))),Q9KPR4_VIBCH/138-187)),(SIGY_BACSU/124-173,Q9KF66_BACHD/114-163)),((Q9L1Z6_STRCO/151-200,(P73744_SYNY3/126-175,Q9WWP4_SYNP2/141-190)),(O53798_MYCBO/119-168,Q9L1U1_STRCO/136-185))),(CARQ_MYXXA/114-163,Q9RXX5_DEIRA/171-219)),((SIGV_BACSU/109-158,Q9K7J9_BACHD/126-175),(Q9KCF6_BACHD/118-167,O83130_TREPA/103-152))),(Q97E49_CLOAB/131-180,(SIGW_BACSU/133-182,Q9KG50_BACHD/133-182))),Q9R393_PSESX/129-178),Q98CJ9_RHILO/127-176),((((O86856_STRCO/135-183,(Q9EXR8_BRAJA/106-155,Q9KIN1_PSEFL/20-69)),Q9RKI2_STRCO/138-187),(O68520_MYXXA/129-178,Q9XCD8_MYCSM/141-190)),Q9X1T4_THEMA/130-178)),(O85900_SPHAR/123-172,Q983W6_RHILO/124-173)),O05735_MYCAV/186-235),P73431_SYNY3/166-215),Q9KPA6_VIBCH/135-184,Q9RCH4_AZOVI/135-184);
ATL  76.3992
DNO  162
DLN  162
DID  0.41322
DPH  ((((((((((((((HRDB_STRCO/446-499:0.20485,(((((Q9ZPL1_MAIZE/457-510:0.20814,Q9ZPL2_MAIZE/469-522:0.17550):0.20894,(((((Q9ZNX9_ARATH/452-505:0.39698,O67437_AQUAE/245-298:0.24053):0.05907,Q9ZSL6_ARATH/351-404:0.43383):0.08138,(Q9LD95_ARATH/479-532:0.41761,O22056_ARATH/504-557:0.20254):0.18490):0.11662,O22058_ARATH/505-558:0.34708):0.04683,(((O08332_STAAU/303-356:0.18245,((RP32_ZYMMO/235-286:0.24109,Q9ZDM4_RICPR/232-283:0.37647):0.16914,Q9S4T1_LEGPN/275-328:0.27050):0.11913):0.06952,((RPOD_TREPA/545-598:0.29504,RPOD_BORBU/563-616:0.22115):0.10047,Q59302_CHLPS/489-542:0.29020):0.04171):0.10100,(Q39515_CYACA/524-577:0.23865,(Q39477_CYACA/543-596:0.31486,Q9ZTL1_CYACA/507-560:0.13106):0.19303):0.06298):0.08652):0.09867):0.08873,RPOD_SYNY3/360-413:0.14041):0.04496,((((RPSC_SYNY3/336-389:0.24854,((Q9FD90_SYNEL/330-383:0.19256,RPSC_ANASP/348-401:0.22355):0.06243,P96035_SYNSP/330-383:0.10893):0.11738):0.01784,Q9R6V7_SYNP7/247-300:0.27587):0.03568,((((((Q55350_SYNSP/256-309:0.19906,Q9KHE5_ANASP/263-316:0.21370):0.07825,Q55525_SYNY3/280-333:0.22596):0.03175,(RPSB_ANASP/268-321:0.41245,P96032_SYNSP/263-316:0.08436):0.03066):0.09705,Q9R6V8_SYNP7/256-309:0.34155):0.05417,(P73666_SYNY3/254-307:0.15038,Q9KHE8_ANASP/268-321:0.21880):0.08934):0.02817,P96034_SYNSP/253-306:0.21891):0.16929):0.07087,(P73710_SYNY3/305-358:0.20718,P94906_MICAE/311-364:0.20114):0.20352):0.12305):0.13322,((O83976_TREPA/246-299:0.46983,P71149_CHLTE/233-286:0.23625):0.19749,O08348_XANCP/555-608:0.16855):0.10457):0.05855):0.03835,(Q9EZJ8_THEAQ/372-425:0.22631,(O67464_AQUAE/510-563:0.26985,P77996_THETU/196-248:0.38532):0.09453):0.17324):0.06652,(((((((Q53611_STIAU/224-275:0.34690,(((P94330_BRAJA/230-281:0.06840,Q98FJ9_RHILO/230-281:0.13200):0.04875,(P94333_BRAJA/239-290:0.35554,P77830_BRAJA/230-281:0.24817):0.04175):0.05713,((O30806_RHOCA/233-284:0.15045,RP32_CAUCR/230-281:0.14806):0.04064,P95657_RHOSH/232-283:0.14602):0.06993):0.06249):0.04183,(Q9LA67_RHIME/223-274:0.26706,Q98FA7_RHILO/222-273:0.12413):0.14649):0.06497,((O82849_PSEHY/248-299:0.22958,Q9JVA9_NEIMA/229-281:0.25517):0.05170,(Q9KJX7_PSEPU/229-280:0.11170,(Q9CKM7_PASMU/226-277:0.21095,Q9LAQ0_COXBU/232-283:0.25902):0.15755):0.24946):0.19401):0.07164,Q9ZIL3_MYXXA/212-263:0.46668):0.01730,((O52607_RALSO/310-363:0.23639,Q9JP89_RHOGE/256-309:0.13538):0.11522,(Q9KI19_COXBU/285-338:0.37548,(O08372_ENTCL/278-331:0.27744,O33503_PSETO/269-322:0.18201):0.11700):0.13357):0.12731):0.10995,((P71106_CHLAU/281-334:0.19916,P77842_CHLAU/331-384:0.17963):0.03394,P77840_CHLAU/278-331:0.21260):0.12417):0.01511,(HRDA_STRCO/331-384:0.16724,((P77906_MYCTU/280-333:0.12950,Q79VF3_CORGL/266-319:0.18924):0.12589,((HRDD_STRCO/268-321:0.36712,HRDC_STRCO/274-327:0.16864):0.08415,P77841_CHLAU/245-298:0.27539):0.04598):0.03873):0.05822):0.02773):0.16671,(P77959_STRRP/222-271:0.27481,((Q9AES5_AERHY/181-230:0.28652,((O84064_CHLTR/198-247:0.28094,(Q97H70_CLOAB/184-233:0.23485,(O34843_BACSU/132-181:0.62499,(O67268_AQUAE/181-230:0.42745,Q9X004_THEMA/162-211:0.25376):0.09350):0.05789):0.10213):0.11077,O25676_HELPY/199-248:0.31383):0.21744):0.15513,((FLIA_PSEAE/190-239:0.14095,((Q9Z5S6_ZYMMO/188-237:0.37224,Q9KQD4_VIBCH/186-235:0.27207):0.06342,FLIA_YEREN/175-224:0.19648):0.12545):0.03544,Q9L774_XANOR/186-235:0.11750):0.06642):0.08046):0.13712):0.10528,((((((O85017_LISIN/202-251:0.19169,((RPSB_BACAN/202-251:0.29799,Q9KFF0_BACHD/202-251:0.23932):0.03355,Q99SI8_STAAN/203-252:0.28967):0.03903):0.07386,O50232_BACLI/204-253:0.28078):0.14274,(RPSE_CLOAB/176-229:0.27735,Q9K9T9_BACHD/178-231:0.23949):0.11102):0.04885,Q9KDC8_BACHD/172-225:0.46845):0.14360,(O32725_BACSH/197-246:0.34452,(RPSF_BACLI/199-248:0.09884,P70879_BACCO/199-248:0.28818):0.06185):0.15984):0.40741,((Q9ADM4_STRCO/264-313:0.10446,Q9RIS5_STRCO/249-298:0.15171):0.05717,((((O52313_STRCO/207-256:0.13403,O86702_STRCO/207-256:0.10834):0.02300,Q9K4K0_STRCO/222-271:0.15613):0.14066,Q9ZIV9_9ACTO/288-337:0.23546):0.05265,Q9X7S2_STRCO/237-286:0.19370):0.00000):0.05522):0.11950):0.17939,(((Q9A9J9_CAUCR/124-173:0.53654,(Q9I3Y1_PSEAE/188-237:0.32905,Q9L430_BORBR/119-168:0.16688):0.03707):0.05345,Q9I444_PSEAE/118-167:0.20162):0.07516,(Q9I6Y3_PSEAE/117-166:0.38618,(Q9I222_PSEAE/116-165:0.21572,Q9I646_PSEAE/116-165:0.36403):0.21463):0.07820):0.17071):0.03576,(Q9HYV8_PSEAE/143-192:0.44058,O83130_TREPA/103-152:0.45650):0.14825):0.04566,(((((Q9A3F1_CAUCR/123-172:0.54798,Q9A7S1_CAUCR/130-179:0.55427):0.10040,Q9AD34_STRCO/172-221:0.37383):0.08731,Q9L1Z6_STRCO/151-200:0.20951):0.03598,O53798_MYCBO/119-168:0.55316):0.08703,((O53730_MYCTU/133-182:0.41020,Q9S2A7_STRCO/130-179:0.20109):0.17066,(((Q9L1U1_STRCO/136-185:0.25444,Q9R393_PSESX/129-178:0.49662):0.24316,((Q55192_SYNY3/129-178:0.44408,(Q9K7Z1_BACHD/126-175:0.49763,Q9AAF3_CAUCR/146-195:0.24689):0.11917):0.07001,Q98BR7_RHILO/124-173:0.47781):0.06584):0.04704,(Q984A3_RHILO/162-211:0.42055,Q9RI52_STRCO/141-190:0.23004):0.08409):0.02215):0.05872):0.04026):0.02145,(((P73744_SYNY3/126-175:0.34089,Q9WWP4_SYNP2/141-190:0.18157):0.33019,((Q9X8Z1_STRCO/115-163:0.46101,(O68887_STRAT/108-157:0.29850,Q983W6_RHILO/124-173:0.28220):0.06389):0.03924,O85900_SPHAR/123-172:0.23833):0.04026):0.03779,(((CARQ_MYXXA/114-163:0.34641,O05735_MYCAV/186-235:0.20234):0.07510,Q9RXX5_DEIRA/171-219:0.34772):0.05098,((Q9RKI2_STRCO/138-187:0.16325,((Q9EXR8_BRAJA/106-155:0.27993,Q9KIN1_PSEFL/20-69:0.32760):0.10552,O86856_STRCO/135-183:0.43234):0.06359):0.09784,(O68520_MYXXA/129-178:0.21010,Q9XCD8_MYCSM/141-190:0.26732):0.11798):0.06613):0.03009):0.03573):0.09604,(Q98L14_RHILO/130-179:0.40154,P74595_SYNY3/202-251:0.53061):0.21047):0.13629,((Q9X6P9_LEPIN/119-168:0.61604,(SIGV_BACSU/109-158:0.24523,Q9K7J9_BACHD/126-175:0.58232):0.15985):0.03786,(Q9I2W5_PSEAE/108-157:0.54451,Q9KF66_BACHD/114-163:0.44759):0.08950):0.11023):0.06469,((Q9KBA2_BACHD/122-171:0.41143,Q9KPR4_VIBCH/138-187:0.39033):0.18951,(Q9X1T4_THEMA/130-178:0.38669,((Q97E49_CLOAB/131-180:0.24685,O07627_BACSU/113-162:0.54194):0.09611,((SIGY_BACSU/124-173:0.52835,Q9KCF6_BACHD/118-167:0.26397):0.16821,(SIGW_BACSU/133-182:0.17520,(Q98CJ9_RHILO/127-176:0.48851,Q9KG50_BACHD/133-182:0.25492):0.15158):0.15098):0.05070):0.08071):0.05889):0.10185):0.15199,P73431_SYNY3/166-215:0.30398):0.22522,Q9KPA6_VIBCH/135-184:0.13577,Q9RCH4_AZOVI/135-184:0.20392);
DTP  ((((((((((((((HRDB_STRCO/446-499,(((((Q9ZPL1_MAIZE/457-510,Q9ZPL2_MAIZE/469-522),(((((Q9ZNX9_ARATH/452-505,O67437_AQUAE/245-298),Q9ZSL6_ARATH/351-404),(Q9LD95_ARATH/479-532,O22056_ARATH/504-557)),O22058_ARATH/505-558),(((O08332_STAAU/303-356,((RP32_ZYMMO/235-286,Q9ZDM4_RICPR/232-283),Q9S4T1_LEGPN/275-328)),((RPOD_TREPA/545-598,RPOD_BORBU/563-616),Q59302_CHLPS/489-542)),(Q39515_CYACA/524-577,(Q39477_CYACA/543-596,Q9ZTL1_CYACA/507-560))))),RPOD_SYNY3/360-413),((((RPSC_SYNY3/336-389,((Q9FD90_SYNEL/330-383,RPSC_ANASP/348-401),P96035_SYNSP/330-383)),Q9R6V7_SYNP7/247-300),((((((Q55350_SYNSP/256-309,Q9KHE5_ANASP/263-316),Q55525_SYNY3/280-333),(RPSB_ANASP/268-321,P96032_SYNSP/263-316)),Q9R6V8_SYNP7/256-309),(P73666_SYNY3/254-307,Q9KHE8_ANASP/268-321)),P96034_SYNSP/253-306)),(P73710_SYNY3/305-358,P94906_MICAE/311-364))),((O83976_TREPA/246-299,P71149_CHLTE/233-286),O08348_XANCP/555-608))),(Q9EZJ8_THEAQ/372-425,(O67464_AQUAE/510-563,P77996_THETU/196-248))),(((((((Q53611_STIAU/224-275,(((P94330_BRAJA/230-281,Q98FJ9_RHILO/230-281),(P94333_BRAJA/239-290,P77830_BRAJA/230-281)),((O30806_RHOCA/233-284,RP32_CAUCR/230-281),P95657_RHOSH/232-283))),(Q9LA67_RHIME/223-274,Q98FA7_RHILO/222-273)),((O82849_PSEHY/248-299,Q9JVA9_NEIMA/229-281),(Q9KJX7_PSEPU/229-280,(Q9CKM7_PASMU/226-277,Q9LAQ0_COXBU/232-283)))),Q9ZIL3_MYXXA/212-263),((O52607_RALSO/310-363,Q9JP89_RHOGE/256-309),(Q9KI19_COXBU/285-338,(O08372_ENTCL/278-331,O33503_PSETO/269-322)))),((P71106_CHLAU/281-334,P77842_CHLAU/331-384),P77840_CHLAU/278-331)),(HRDA_STRCO/331-384,((P77906_MYCTU/280-333,Q79VF3_CORGL/266-319),((HRDD_STRCO/268-321,HRDC_STRCO/274-327),P77841_CHLAU/245-298))))),(P77959_STRRP/222-271,((Q9AES5_AERHY/181-230,((O84064_CHLTR/198-247,(Q97H70_CLOAB/184-233,(O34843_BACSU/132-181,(O67268_AQUAE/181-230,Q9X004_THEMA/162-211)))),O25676_HELPY/199-248)),((FLIA_PSEAE/190-239,((Q9Z5S6_ZYMMO/188-237,Q9KQD4_VIBCH/186-235),FLIA_YEREN/175-224)),Q9L774_XANOR/186-235)))),((((((O85017_LISIN/202-251,((RPSB_BACAN/202-251,Q9KFF0_BACHD/202-251),Q99SI8_STAAN/203-252)),O50232_BACLI/204-253),(RPSE_CLOAB/176-229,Q9K9T9_BACHD/178-231)),Q9KDC8_BACHD/172-225),(O32725_BACSH/197-246,(RPSF_BACLI/199-248,P70879_BACCO/199-248))),((Q9ADM4_STRCO/264-313,Q9RIS5_STRCO/249-298),((((O52313_STRCO/207-256,O86702_STRCO/207-256),Q9K4K0_STRCO/222-271),Q9ZIV9_9ACTO/288-337),Q9X7S2_STRCO/237-286)))),(((Q9A9J9_CAUCR/124-173,(Q9I3Y1_PSEAE/188-237,Q9L430_BORBR/119-168)),Q9I444_PSEAE/118-167),(Q9I6Y3_PSEAE/117-166,(Q9I222_PSEAE/116-165,Q9I646_PSEAE/116-165)))),(Q9HYV8_PSEAE/143-192,O83130_TREPA/103-152)),(((((Q9A3F1_CAUCR/123-172,Q9A7S1_CAUCR/130-179),Q9AD34_STRCO/172-221),Q9L1Z6_STRCO/151-200),O53798_MYCBO/119-168),((O53730_MYCTU/133-182,Q9S2A7_STRCO/130-179),(((Q9L1U1_STRCO/136-185,Q9R393_PSESX/129-178),((Q55192_SYNY3/129-178,(Q9K7Z1_BACHD/126-175,Q9AAF3_CAUCR/146-195)),Q98BR7_RHILO/124-173)),(Q984A3_RHILO/162-211,Q9RI52_STRCO/141-190))))),(((P73744_SYNY3/126-175,Q9WWP4_SYNP2/141-190),((Q9X8Z1_STRCO/115-163,(O68887_STRAT/108-157,Q983W6_RHILO/124-173)),O85900_SPHAR/123-172)),(((CARQ_MYXXA/114-163,O05735_MYCAV/186-235),Q9RXX5_DEIRA/171-219),((Q9RKI2_STRCO/138-187,((Q9EXR8_BRAJA/106-155,Q9KIN1_PSEFL/20-69),O86856_STRCO/135-183)),(O68520_MYXXA/129-178,Q9XCD8_MYCSM/141-190))))),(Q98L14_RHILO/130-179,P74595_SYNY3/202-251)),((Q9X6P9_LEPIN/119-168,(SIGV_BACSU/109-158,Q9K7J9_BACHD/126-175)),(Q9I2W5_PSEAE/108-157,Q9KF66_BACHD/114-163))),((Q9KBA2_BACHD/122-171,Q9KPR4_VIBCH/138-187),(Q9X1T4_THEMA/130-178,((Q97E49_CLOAB/131-180,O07627_BACSU/113-162),((SIGY_BACSU/124-173,Q9KCF6_BACHD/118-167),(SIGW_BACSU/133-182,(Q98CJ9_RHILO/127-176,Q9KG50_BACHD/133-182))))))),P73431_SYNY3/166-215),Q9KPA6_VIBCH/135-184,Q9RCH4_AZOVI/135-184);
DTL  61.5766
RID  0.299994
RPH  (((((((((((((((((((((((((Q9KI19_COXBU/285-338:0.31298,((O52607_RALSO/310-363:0.21029,Q9JP89_RHOGE/256-309:0.26403):0.19955,((O08372_ENTCL/278-331:0.16031,O33503_PSETO/269-322:0.11158):0.05250,Q9S4T1_LEGPN/275-328:0.27201):0.20624):0.07615):0.37942,((((Q55525_SYNY3/280-333:0.12240,((RPSB_ANASP/268-321:0.36709,P96032_SYNSP/263-316:0.09026):0.07850,(Q55350_SYNSP/256-309:0.22195,Q9KHE5_ANASP/263-316:0.10474):0.05406):0.05432):0.11526,P96034_SYNSP/253-306:0.23531):0.10204,(P73666_SYNY3/254-307:0.09421,Q9KHE8_ANASP/268-321:0.15237):0.01886):0.02270,Q9R6V8_SYNP7/256-309:0.35974):0.18760):0.06164,((P96035_SYNSP/330-383:0.16568,(RPSC_ANASP/348-401:0.14052,Q9FD90_SYNEL/330-383:0.15679):0.06504):0.07282,(RPSC_SYNY3/336-389:0.21028,Q9R6V7_SYNP7/247-300:0.32258):0.06171):0.03253):0.15266,(P73710_SYNY3/305-358:0.15426,P94906_MICAE/311-364:0.07315):0.31394):0.10408,(((P77841_CHLAU/245-298:0.33664,HRDC_STRCO/274-327:0.40817):0.15407,HRDD_STRCO/268-321:0.52955):0.20277,(P77996_THETU/196-248:0.65109,((((O22058_ARATH/505-558:0.49018,(P77906_MYCTU/280-333:0.08356,Q79VF3_CORGL/266-319:0.18010):0.16763):0.08279,(HRDA_STRCO/331-384:0.18280,HRDB_STRCO/446-499:0.20089):0.09722):0.05708,((Q9ZPL1_MAIZE/457-510:0.25141,Q9ZPL2_MAIZE/469-522:0.13098):0.06430,O22056_ARATH/504-557:0.17656):0.24425):0.00000,(((Q39515_CYACA/524-577:0.15309,((RPOD_TREPA/545-598:0.18578,RPOD_BORBU/563-616:0.18675):0.18505,(Q39477_CYACA/543-596:0.31858,Q9ZTL1_CYACA/507-560:0.15142):0.17765):0.03263):0.07973,(((Q59302_CHLPS/489-542:0.23296,O08332_STAAU/303-356:0.08379):0.03268,O08348_XANCP/555-608:0.31446):0.03137,RPOD_SYNY3/360-413:0.13328):0.05499):0.03965,(((P71106_CHLAU/281-334:0.09775,P77840_CHLAU/278-331:0.22658):0.20288,P77842_CHLAU/331-384:0.07890):0.10963,(O67464_AQUAE/510-563:0.18542,Q9EZJ8_THEAQ/372-425:0.24328):0.08526):0.12242):0.02722):0.02984):0.00000):0.10742):0.07342,(Q9LD95_ARATH/479-532:0.47303,((Q9ZNX9_ARATH/452-505:0.63601,Q9ZSL6_ARATH/351-404:0.51273):0.05068,(O83976_TREPA/246-299:0.46841,P71149_CHLTE/233-286:0.37132):0.19419):0.08318):0.00000):0.20973,O67437_AQUAE/245-298:0.21766):0.11161,((Q9ZIL3_MYXXA/212-263:0.71686,Q53611_STIAU/224-275:0.43152):0.12870,((((O82849_PSEHY/248-299:0.16900,(Q9CKM7_PASMU/226-277:0.21888,(Q9KJX7_PSEPU/229-280:0.06880,Q9LAQ0_COXBU/232-283:0.22497):0.18533):0.27691):0.10818,Q9JVA9_NEIMA/229-281:0.19570):0.22110,(((P94333_BRAJA/239-290:0.41615,P77830_BRAJA/230-281:0.20244):0.07622,(P94330_BRAJA/230-281:0.06911,Q98FJ9_RHILO/230-281:0.14975):0.11288):0.09191,(((Q9ZDM4_RICPR/232-283:0.47506,RP32_ZYMMO/235-286:0.12901):0.05172,RP32_CAUCR/230-281:0.11059):0.05462,(O30806_RHOCA/233-284:0.15439,P95657_RHOSH/232-283:0.13311):0.08478):0.07334):0.19191):0.11237,(Q98FA7_RHILO/222-273:0.23997,Q9LA67_RHIME/223-274:0.21043):0.12727):0.11794):0.32584):0.21596,(((RPSE_CLOAB/176-229:0.12705,Q9K9T9_BACHD/178-231:0.16140):0.04221,((O32725_BACSH/197-246:0.34777,(RPSF_BACLI/199-248:0.00000,P70879_BACCO/199-248:0.26076):0.11103):0.38818,((((Q99SI8_STAAN/203-252:0.20572,(O85017_LISIN/202-251:0.12979,RPSB_BACAN/202-251:0.36997):0.07121):0.05276,Q9KFF0_BACHD/202-251:0.25600):0.12179,O50232_BACLI/204-253:0.05892):0.24041,((((((Q9K4K0_STRCO/222-271:0.27478,O86702_STRCO/207-256:0.00000):0.11831,O52313_STRCO/207-256:0.17891):0.31170,Q9ADM4_STRCO/264-313:0.11179):0.13925,Q9RIS5_STRCO/249-298:0.14433):0.21124,Q9ZIV9_9ACTO/288-337:0.34098):0.10150,Q9X7S2_STRCO/237-286:0.15390):0.31565):0.09806):0.08457):0.18203,Q9KDC8_BACHD/172-225:0.46229):0.14213):0.13583,(O67268_AQUAE/181-230:0.39243,(((O84064_CHLTR/198-247:0.33664,(Q97H70_CLOAB/184-233:0.38430,((O34843_BACSU/132-181:0.74727,Q9X004_THEMA/162-211:0.20923):0.11058,P77959_STRRP/222-271:0.28440):0.03741):0.04229):0.08154,(((Q9Z5S6_ZYMMO/188-237:0.45334,Q9KQD4_VIBCH/186-235:0.09256):0.10540,(FLIA_YEREN/175-224:0.18302,(Q9AES5_AERHY/181-230:0.53183,Q9L774_XANOR/186-235:0.03315):0.16757):0.04202):0.00000,FLIA_PSEAE/190-239:0.15531):0.14879):0.14789,O25676_HELPY/199-248:0.46645):0.06630):0.11433):0.22394,Q9X6P9_LEPIN/119-168:0.80534):0.20659,((Q98BR7_RHILO/124-173:0.56575,Q9X8Z1_STRCO/115-163:0.70553):0.26539,(P74595_SYNY3/202-251:0.60385,(Q98L14_RHILO/130-179:0.64993,((((Q9A9J9_CAUCR/124-173:0.49036,Q9I3Y1_PSEAE/188-237:0.36431):0.09688,(Q9I444_PSEAE/118-167:0.28221,Q9L430_BORBR/119-168:0.37800):0.10785):0.16492,(Q9I6Y3_PSEAE/117-166:0.52461,(Q9I222_PSEAE/116-165:0.64433,Q9I646_PSEAE/116-165:0.48318):0.63415):0.06045):0.28079,Q9A3F1_CAUCR/123-172:0.67639):0.05035):0.09199):0.12076):0.20764):0.00000,(O07627_BACSU/113-162:0.32133,Q9HYV8_PSEAE/143-192:0.72050):0.36390):0.04186,Q9KBA2_BACHD/122-171:0.61387):0.05015,((Q9AD34_STRCO/172-221:0.96194,Q9I2W5_PSEAE/108-157:0.96986):0.21490,O68887_STRAT/108-157:0.49579):0.12966):0.03277,((((Q55192_SYNY3/129-178:0.24034,(O53730_MYCTU/133-182:0.46286,Q9S2A7_STRCO/130-179:0.32521):0.35495):0.20422,((Q9A7S1_CAUCR/130-179:0.72733,(Q984A3_RHILO/162-211:0.39155,Q9RI52_STRCO/141-190:0.34797):0.19549):0.04202,(Q9K7Z1_BACHD/126-175:0.64906,Q9AAF3_CAUCR/146-195:0.35323):0.17250):0.02336):0.15939,Q9KPR4_VIBCH/138-187:0.59036):0.16337,(SIGY_BACSU/124-173:0.62269,Q9KF66_BACHD/114-163:0.52050):0.32538):0.00000):0.07703,Q9R393_PSESX/129-178:0.98030):0.00989,(((SIGV_BACSU/109-158:0.41582,Q9K7J9_BACHD/126-175:0.63341):0.26460,((Q9L1Z6_STRCO/151-200:0.29221,(O53798_MYCBO/119-168:0.43592,Q9L1U1_STRCO/136-185:0.55314):0.23167):0.09033,(P73744_SYNY3/126-175:0.34424,Q9WWP4_SYNP2/141-190:0.09613):0.32895):0.22044):0.04366,((CARQ_MYXXA/114-163:0.77707,Q9RXX5_DEIRA/171-219:0.20261):0.28883,O83130_TREPA/103-152:0.51975):0.16928):0.02376):0.02611,((Q97E49_CLOAB/131-180:0.40009,(SIGW_BACSU/133-182:0.21330,Q9KG50_BACHD/133-182:0.20743):0.22692):0.08887,(Q98CJ9_RHILO/127-176:0.45987,Q9KCF6_BACHD/118-167:0.54935):0.19169):0.06877):0.10126,Q9X1T4_THEMA/130-178:0.37860):0.03753,(O85900_SPHAR/123-172:0.62137,Q983W6_RHILO/124-173:0.36554):0.11632):0.01956,(((O86856_STRCO/135-183:0.64251,(Q9EXR8_BRAJA/106-155:0.22782,Q9KIN1_PSEFL/20-69:0.28498):0.11228):0.13822,Q9RKI2_STRCO/138-187:0.29775):0.18510,(O68520_MYXXA/129-178:0.28522,Q9XCD8_MYCSM/141-190:0.30070):0.13336):0.14333):0.09896,O05735_MYCAV/186-235:0.35690):0.15275,P73431_SYNY3/166-215:0.36560):0.39858,Q9KPA6_VIBCH/135-184:0.00000,Q9RCH4_AZOVI/135-184:0.29902);
RTP  (((((((((((((((((((((((((Q9KI19_COXBU/285-338,((O52607_RALSO/310-363,Q9JP89_RHOGE/256-309),((O08372_ENTCL/278-331,O33503_PSETO/269-322),Q9S4T1_LEGPN/275-328))),((((Q55525_SYNY3/280-333,((RPSB_ANASP/268-321,P96032_SYNSP/263-316),(Q55350_SYNSP/256-309,Q9KHE5_ANASP/263-316))),P96034_SYNSP/253-306),(P73666_SYNY3/254-307,Q9KHE8_ANASP/268-321)),Q9R6V8_SYNP7/256-309)),((P96035_SYNSP/330-383,(RPSC_ANASP/348-401,Q9FD90_SYNEL/330-383)),(RPSC_SYNY3/336-389,Q9R6V7_SYNP7/247-300))),(P73710_SYNY3/305-358,P94906_MICAE/311-364)),(((P77841_CHLAU/245-298,HRDC_STRCO/274-327),HRDD_STRCO/268-321),(P77996_THETU/196-248,((((O22058_ARATH/505-558,(P77906_MYCTU/280-333,Q79VF3_CORGL/266-319)),(HRDA_STRCO/331-384,HRDB_STRCO/446-499)),((Q9ZPL1_MAIZE/457-510,Q9ZPL2_MAIZE/469-522),O22056_ARATH/504-557)),(((Q39515_CYACA/524-577,((RPOD_TREPA/545-598,RPOD_BORBU/563-616),(Q39477_CYACA/543-596,Q9ZTL1_CYACA/507-560))),(((Q59302_CHLPS/489-542,O08332_STAAU/303-356),O08348_XANCP/555-608),RPOD_SYNY3/360-413)),(((P71106_CHLAU/281-334,P77840_CHLAU/278-331),P77842_CHLAU/331-384),(O67464_AQUAE/510-563,Q9EZJ8_THEAQ/372-425))))))),(Q9LD95_ARATH/479-532,((Q9ZNX9_ARATH/452-505,Q9ZSL6_ARATH/351-404),(O83976_TREPA/246-299,P71149_CHLTE/233-286)))),O67437_AQUAE/245-298),((Q9ZIL3_MYXXA/212-263,Q53611_STIAU/224-275),((((O82849_PSEHY/248-299,(Q9CKM7_PASMU/226-277,(Q9KJX7_PSEPU/229-280,Q9LAQ0_COXBU/232-283))),Q9JVA9_NEIMA/229-281),(((P94333_BRAJA/239-290,P77830_BRAJA/230-281),(P94330_BRAJA/230-281,Q98FJ9_RHILO/230-281)),(((Q9ZDM4_RICPR/232-283,RP32_ZYMMO/235-286),RP32_CAUCR/230-281),(O30806_RHOCA/233-284,P95657_RHOSH/232-283)))),(Q98FA7_RHILO/222-273,Q9LA67_RHIME/223-274)))),(((RPSE_CLOAB/176-229,Q9K9T9_BACHD/178-231),((O32725_BACSH/197-246,(RPSF_BACLI/199-248,P70879_BACCO/199-248)),((((Q99SI8_STAAN/203-252,(O85017_LISIN/202-251,RPSB_BACAN/202-251)),Q9KFF0_BACHD/202-251),O50232_BACLI/204-253),((((((Q9K4K0_STRCO/222-271,O86702_STRCO/207-256),O52313_STRCO/207-256),Q9ADM4_STRCO/264-313),Q9RIS5_STRCO/249-298),Q9ZIV9_9ACTO/288-337),Q9X7S2_STRCO/237-286)))),Q9KDC8_BACHD/172-225)),(O67268_AQUAE/181-230,(((O84064_CHLTR/198-247,(Q97H70_CLOAB/184-233,((O34843_BACSU/132-181,Q9X004_THEMA/162-211),P77959_STRRP/222-271))),(((Q9Z5S6_ZYMMO/188-237,Q9KQD4_VIBCH/186-235),(FLIA_YEREN/175-224,(Q9AES5_AERHY/181-230,Q9L774_XANOR/186-235))),FLIA_PSEAE/190-239)),O25676_HELPY/199-248))),Q9X6P9_LEPIN/119-168),((Q98BR7_RHILO/124-173,Q9X8Z1_STRCO/115-163),(P74595_SYNY3/202-251,(Q98L14_RHILO/130-179,((((Q9A9J9_CAUCR/124-173,Q9I3Y1_PSEAE/188-237),(Q9I444_PSEAE/118-167,Q9L430_BORBR/119-168)),(Q9I6Y3_PSEAE/117-166,(Q9I222_PSEAE/116-165,Q9I646_PSEAE/116-165))),Q9A3F1_CAUCR/123-172))))),(O07627_BACSU/113-162,Q9HYV8_PSEAE/143-192)),Q9KBA2_BACHD/122-171),((Q9AD34_STRCO/172-221,Q9I2W5_PSEAE/108-157),O68887_STRAT/108-157)),((((Q55192_SYNY3/129-178,(O53730_MYCTU/133-182,Q9S2A7_STRCO/130-179)),((Q9A7S1_CAUCR/130-179,(Q984A3_RHILO/162-211,Q9RI52_STRCO/141-190)),(Q9K7Z1_BACHD/126-175,Q9AAF3_CAUCR/146-195))),Q9KPR4_VIBCH/138-187),(SIGY_BACSU/124-173,Q9KF66_BACHD/114-163))),Q9R393_PSESX/129-178),(((SIGV_BACSU/109-158,Q9K7J9_BACHD/126-175),((Q9L1Z6_STRCO/151-200,(O53798_MYCBO/119-168,Q9L1U1_STRCO/136-185)),(P73744_SYNY3/126-175,Q9WWP4_SYNP2/141-190))),((CARQ_MYXXA/114-163,Q9RXX5_DEIRA/171-219),O83130_TREPA/103-152))),((Q97E49_CLOAB/131-180,(SIGW_BACSU/133-182,Q9KG50_BACHD/133-182)),(Q98CJ9_RHILO/127-176,Q9KCF6_BACHD/118-167))),Q9X1T4_THEMA/130-178),(O85900_SPHAR/123-172,Q983W6_RHILO/124-173)),(((O86856_STRCO/135-183,(Q9EXR8_BRAJA/106-155,Q9KIN1_PSEFL/20-69)),Q9RKI2_STRCO/138-187),(O68520_MYXXA/129-178,Q9XCD8_MYCSM/141-190))),O05735_MYCAV/186-235),P73431_SYNY3/166-215),Q9KPA6_VIBCH/135-184,Q9RCH4_AZOVI/135-184);
RTL  75.4629
LNK  CARQ_MYXXA/114-163:Q06909:X71062
LNK  FLIA_PSEAE/190-239:P29248:X61231
LNK  FLIA_YEREN/175-224:P52621:U17393
LNK  HRDA_STRCO/331-384:P18182:AL939112
LNK  HRDB_STRCO/446-499:P18183:AL939125
LNK  HRDC_STRCO/274-327:P18184:X52981
LNK  HRDD_STRCO/268-321:P18249:X52982
LNK  O05735_MYCAV/186-235:O05735:U87308
LNK  O07627_BACSU/113-162:O07627:Z97025
LNK  O08332_STAAU/303-356:O08332:AB001896
LNK  O08348_XANCP/555-608:O08348:U82763
LNK  O08372_ENTCL/278-331:O08372:Y13230
LNK  O22056_ARATH/504-557:O22056:AB004820
LNK  O22058_ARATH/505-558:O22058:AB004822
LNK  O25676_HELPY/199-248:O25676:AE000611
LNK  O30806_RHOCA/233-284:O30806:AF017436
LNK  O32725_BACSH/197-246:O32725:L47359
LNK  O33503_PSETO/269-322:O33503:AB006073
LNK  O34843_BACSU/132-181:O34843:Z99120
LNK  O50232_BACLI/204-253:O50232:AF034567
LNK  O52313_STRCO/207-256:O52313:AF036131
LNK  O52607_RALSO/310-363:O52607:AF042351
LNK  O53730_MYCTU/133-182:O53730:BX842573
LNK  O53798_MYCBO/119-168:O53798:BX248336
LNK  O67268_AQUAE/181-230:O67268:AE000729
LNK  O67437_AQUAE/245-298:O67437:AE000741
LNK  O67464_AQUAE/510-563:O67464:AE000742
LNK  O68520_MYXXA/129-178:O68520:AF049107
LNK  O68887_STRAT/108-157:O68887:AF056199
LNK  O82849_PSEHY/248-299:O82849:AB009991
LNK  O83130_TREPA/103-152:O83130:AE001193
LNK  O83707_TREPA/203-252:O83707:
LNK  O83976_TREPA/246-299:O83976:AE001269
LNK  O84064_CHLTR/198-247:O84064:AE001281
LNK  O85017_LISIN/202-251:O85017:AF032447
LNK  O85900_SPHAR/123-172:O85900:AF079317
LNK  O86702_STRCO/207-256:O86702:AL939128
LNK  O86856_STRCO/135-183:O86856:AJ007313
LNK  P70879_BACCO/199-248:P70879:Z54161
LNK  P71106_CHLAU/281-334:P71106:U67720
LNK  P71149_CHLTE/233-286:P71149:U67718
LNK  P73431_SYNY3/166-215:P73431:BA000022
LNK  P73666_SYNY3/254-307:P73666:BA000022
LNK  P73710_SYNY3/305-358:P73710:BA000022
LNK  P73744_SYNY3/126-175:P73744:BA000022
LNK  P74595_SYNY3/202-251:P74595:BA000022
LNK  P77830_BRAJA/230-281:P77830:U55047
LNK  P77840_CHLAU/278-331:P77840:U67719
LNK  P77841_CHLAU/245-298:P77841:U67721
LNK  P77842_CHLAU/331-384:P77842:U67722
LNK  P77906_MYCTU/280-333:P77906:U39806
LNK  P77959_STRRP/222-271:P77959:U58281
LNK  P77996_THETU/196-248:P77996:U50951
LNK  P94330_BRAJA/230-281:P94330:Y09502
LNK  P94333_BRAJA/239-290:P94333:Y09666
LNK  P94906_MICAE/311-364:P94906:D86575
LNK  P95657_RHOSH/232-283:P95657:U82397
LNK  P96032_SYNSP/263-316:P96032:U82435
LNK  P96034_SYNSP/253-306:P96034:U82484
LNK  P96035_SYNSP/330-383:P96035:U82485
LNK  Q39477_CYACA/543-596:Q39477:L42639
LNK  Q39515_CYACA/524-577:Q39515:D83179
LNK  Q53611_STIAU/224-275:Q53611:U27311
LNK  Q55192_SYNY3/129-178:Q55192:BA000022
LNK  Q55350_SYNSP/256-309:Q55350:AB006910
LNK  Q55525_SYNY3/280-333:Q55525:BA000022
LNK  Q59302_CHLPS/489-542:Q59302:U04442
LNK  Q79VF3_CORGL/266-319:Q79VF3:BA000036
LNK  Q97E49_CLOAB/131-180:Q97E49:AE007822
LNK  Q97H70_CLOAB/184-233:Q97H70:AE007715
LNK  Q983W6_RHILO/124-173:Q983W6:BA000012
LNK  Q984A3_RHILO/162-211:Q984A3:BA000012
LNK  Q98BR7_RHILO/124-173:Q98BR7:BA000012
LNK  Q98CJ9_RHILO/127-176:Q98CJ9:BA000012
LNK  Q98FA7_RHILO/222-273:Q98FA7:BA000012
LNK  Q98FJ9_RHILO/230-281:Q98FJ9:BA000012
LNK  Q98L14_RHILO/130-179:Q98L14:BA000012
LNK  Q99SI8_STAAN/203-252:Q99SI8:BA000018
LNK  Q9A3F1_CAUCR/123-172:Q9A3F1:AE005989
LNK  Q9A7S1_CAUCR/130-179:Q9A7S1:AE005839
LNK  Q9A9J9_CAUCR/124-173:Q9A9J9:AE005775
LNK  Q9AAF3_CAUCR/146-195:Q9AAF3:AE005740
LNK  Q9AD34_STRCO/172-221:Q9AD34:AL590463
LNK  Q9ADM4_STRCO/264-313:Q9ADM4:AL939118
LNK  Q9AES5_AERHY/181-230:Q9AES5:AY028400
LNK  Q9CKM7_PASMU/226-277:Q9CKM7:AE006196
LNK  Q9EXR8_BRAJA/106-155:Q9EXR8:AJ304855
LNK  Q9EZJ8_THEAQ/372-425:Q9EZJ8:AF291720
LNK  Q9FD90_SYNEL/330-383:Q9FD90:AF288784
LNK  Q9HYV8_PSEAE/143-192:Q9HYV8:AE004750
LNK  Q9I222_PSEAE/116-165:Q9I222:AE004637
LNK  Q9I2W5_PSEAE/108-157:Q9I2W5:AE004603
LNK  Q9I3Y1_PSEAE/188-237:Q9I3Y1:AE004565
LNK  Q9I444_PSEAE/118-167:Q9I444:AE004559
LNK  Q9I646_PSEAE/116-165:Q9I646:AE004485
LNK  Q9I6Y3_PSEAE/117-166:Q9I6Y3:AE004453
LNK  Q9JP89_RHOGE/256-309:Q9JP89:AB034704
LNK  Q9JVA9_NEIMA/229-281:Q9JVA9:AL162754
LNK  Q9K4K0_STRCO/222-271:Q9K4K0:AL939131
LNK  Q9K7J9_BACHD/126-175:Q9K7J9:BA000004
LNK  Q9K7Z1_BACHD/126-175:Q9K7Z1:BA000004
LNK  Q9K9T9_BACHD/178-231:Q9K9T9:BA000004
LNK  Q9KBA2_BACHD/122-171:Q9KBA2:BA000004
LNK  Q9KCF6_BACHD/118-167:Q9KCF6:BA000004
LNK  Q9KDC8_BACHD/172-225:Q9KDC8:BA000004
LNK  Q9KF66_BACHD/114-163:Q9KF66:BA000004
LNK  Q9KFF0_BACHD/202-251:Q9KFF0:BA000004
LNK  Q9KG50_BACHD/133-182:Q9KG50:BA000004
LNK  Q9KHE5_ANASP/263-316:Q9KHE5:AF262217
LNK  Q9KHE8_ANASP/268-321:Q9KHE8:AF262216
LNK  Q9KI19_COXBU/285-338:Q9KI19:AF244357
LNK  Q9KIN1_PSEFL/20-69:Q9KIN1:AF228766
LNK  Q9KJX7_PSEPU/229-280:Q9KJX7:AF157048
LNK  Q9KPA6_VIBCH/135-184:Q9KPA6:AE004316
LNK  Q9KPR4_VIBCH/138-187:Q9KPR4:AE004301
LNK  Q9KQD4_VIBCH/186-235:Q9KQD4:AE004280
LNK  Q9L1U1_STRCO/136-185:Q9L1U1:AL939114
LNK  Q9L1Z6_STRCO/151-200:Q9L1Z6:AL939113
LNK  Q9L430_BORBR/119-168:Q9L430:AJ251793
LNK  Q9L774_XANOR/186-235:Q9L774:AF226282
LNK  Q9LA67_RHIME/223-274:Q9LA67:AF149031
LNK  Q9LAQ0_COXBU/232-283:Q9LAQ0:AF120928
LNK  Q9LD95_ARATH/479-532:Q9LD95:AB029916
LNK  Q9R393_PSESX/129-178:Q9R393:AB016417
LNK  Q9R6V7_SYNP7/247-300:Q9R6V7:AB024710
LNK  Q9R6V8_SYNP7/256-309:Q9R6V8:AB024709
LNK  Q9RCH4_AZOVI/135-184:Q9RCH4:U22895
LNK  Q9RI52_STRCO/141-190:Q9RI52:AL939104
LNK  Q9RIS5_STRCO/249-298:Q9RIS5:AJ249581
LNK  Q9RKI2_STRCO/138-187:Q9RKI2:AL939116
LNK  Q9RXX5_DEIRA/171-219:Q9RXX5:AE001880
LNK  Q9S2A7_STRCO/130-179:Q9S2A7:AL939110
LNK  Q9S4T1_LEGPN/275-328:Q9S4T1:AF117715
LNK  Q9WWP4_SYNP2/141-190:Q9WWP4:AF121850
LNK  Q9X004_THEMA/162-211:Q9X004:AE001755
LNK  Q9X1T4_THEMA/130-178:Q9X1T4:AE001804
LNK  Q9X6P9_LEPIN/119-168:Q9X6P9:AF143504
LNK  Q9X7S2_STRCO/237-286:Q9X7S2:AL939131
LNK  Q9X8Z1_STRCO/115-163:Q9X8Z1:AL939117
LNK  Q9XCD8_MYCSM/141-190:Q9XCD8:AF144091
LNK  Q9Z5S6_ZYMMO/188-237:Q9Z5S6:AF124349
LNK  Q9ZDM4_RICPR/232-283:Q9ZDM4:AJ235271
LNK  Q9ZIL3_MYXXA/212-263:Q9ZIL3:AF023661
LNK  Q9ZIV9_9ACTO/288-337:Q9ZIV9:AF011410
LNK  Q9ZNX9_ARATH/452-505:Q9ZNX9:Y18550
LNK  Q9ZPL1_MAIZE/457-510:Q9ZPL1:AF099111
LNK  Q9ZPL2_MAIZE/469-522:Q9ZPL2:AF099110
LNK  Q9ZSL6_ARATH/351-404:Q9ZSL6:AF101075
LNK  Q9ZTL1_CYACA/507-560:Q9ZTL1:AF050634
LNK  RP32_CAUCR/230-281:P48194:U37792
LNK  RP32_ZYMMO/235-286:P50512:D50832
LNK  RPOD_BORBU/563-616:P52323:AE001171
LNK  RPOD_SYNY3/360-413:P74565:D90916
LNK  RPOD_TREPA/545-598:O83506:AE001225
LNK  RPSB_ANASP/268-321:Q03065:M95760
LNK  RPSB_BACAN/202-251:Q9K5J6:AJ272497
LNK  RPSB_MYXXA/177-228:P19433:
LNK  RPSC_ANASP/348-401:Q03066:M95759
LNK  RPSC_SYNY3/336-389:Q59996:D64002
LNK  RPSE_CLOAB/176-229:P33657:U07420
LNK  RPSF_BACLI/199-248:P26764:M25260
LNK  SIGV_BACSU/109-158:O05404:U93874
LNK  SIGW_BACSU/133-182:Q45585:AB002150
LNK  SIGY_BACSU/124-173:P94370:D83026
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZTL1_CYACA/507-560
ASQ  ALSQLDFREREVIRMRFGLDDGRTKSLGEVGSLFCVTRERVRQIETRALRKLRD
DSQ  GCTTTGTCCCAGTTGGATTTTCGTGAACGAGAAGTGATTCGAATGCGTTTTGGTTTGGACGATGGAAGAACGAAGAGTTTAGGTGAAGTTGGTAGTTTATTTTGTGTTACTCGTGAACGAGTTCGACAGATTGAGACTCGAGCTTTGAGAAAGTTGAGGGAT
TRN  10110101110011010
NAM  Q39477_CYACA/543-596
ASQ  ALSLLNPYEREVIRMRFGLDDGRMKSVDEVCAYYCVQTSRIRRIEARALRKLRH
DSQ  GCACTTTCTCTTTTGAATCCTTACGAAAGGGAAGTTATTCGGATGAGATTTGGTCTTGACGATGGTCGAATGAAGAGTGTAGACGAAGTTTGTGCCTACTATTGCGTGCAGACTAGTCGTATTCGTAGAATCGAAGCTCGAGCTTTGAGAAAGTTACGGCAT
TRN  10010101110011010
NAM  Q9EZJ8_THEAQ/372-425
ASQ  ALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKY
DSQ  GCCCTTTCCAAGCTCTCCGAGCGGGAAGCCATGGTGCTGAAGCTCCGGAAAGGGCTCATTGACGGCCGGGAGCACACCCTCGAGGAGGTGGGGGCCTACTTTGGCGTGACCCGGGAGCGCATCCGCCAGATTGAGAACAAGGCCTTAAGGAAGCTCAAGTAC
TRN  10010101100011010
NAM  Q59302_CHLPS/489-542
ASQ  VLKTLTDRERFVLIHRFGLLDGKPKTLEEVGSAFNVTRERIRQIEAKALRKMRH
DSQ  GTGTTAAAAACCCTTACGGATCGTGAACGTTTTGTTTTGATTCATCGTTTTGGTCTTTTGGATGGCAAGCCTAAAACACTAGAAGAGGTGGGTTCAGCATTTAATGTGACTCGAGAGCGTATTCGTCAGATTGAAGCTAAGGCTTTGAGAAAAATGCGTCAC
TRN  10010101110011000
NAM  RPOD_SYNY3/360-413
ASQ  VLDTLSPRERDVLRLRYGLDDGRMKTLEEIGQIFNVTRERIRQIEAKALRKLRH
DSQ  GTCCTTGACACCCTCAGCCCCCGGGAACGAGACGTATTGCGTCTACGCTATGGCCTCGACGACGGCCGCATGAAGACCCTAGAAGAGATTGGGCAAATCTTTAACGTCACCCGGGAACGCATCCGTCAGATCGAAGCTAAAGCCCTGCGGAAACTGCGTCAC
TRN  11011101101011011
NAM  O08332_STAAU/303-356
ASQ  VLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRH
DSQ  GTGCTTGATACATTAACTGATAGAGAAGAAAATGTATTACGATTAAGATTTGGTCTTGATGACGGCAGAACAAGAACACTTGAAGAAGTTGGTAAAGTTTTCGGTGTTACACGTGAACGTATTCGACAAATTGAAGCAAAAGCACTTAGAAAATTAAGACAT
TRN  10010101110011010
NAM  P77842_CHLAU/331-384
ASQ  ALDQLSERERRVLELRYGLVDGQPRTLEEVGKAFGVTRERVRQIEVKALRKLRH
DSQ  GCTCTCGATCAGCTCAGCGAACGTGAGCGACGGGTGCTTGAGTTGCGTTACGGCCTGGTTGATGGTCAGCCGCGCACGCTCGAAGAGGTCGGTAAAGCGTTTGGCGTTACCCGCGAGCGGGTACGGCAGATTGAAGTCAAGGCGCTGCGCAAGTTGCGCCAT
TRN  11011101101011011
NAM  Q39515_CYACA/524-577
ASQ  VLHCLSTREREVIRMRFGLTDGRPRTLEEVGSRFNVTRERIRQIESKALKKLRT
DSQ  GTTCTGCACTGTCTTTCAACTCGTGAGAGAGAGGTGATTCGGATGCGCTTCGGTCTCACGGATGGTCGACCGAGAACACTGGAGGAAGTTGGGAGCAGGTTCAATGTTACAAGAGAGCGGATTCGGCAGATAGAATCAAAAGCTTTGAAGAAGCTAAGGACT
TRN  10010101100011001
NAM  O67464_AQUAE/510-563
ASQ  VLSTLSEKEREILMYRYGLVDGTEYTLEQVGKMFNVTRERIRQIENKALRKLRH
DSQ  GTTCTGAGCACGCTTTCCGAAAAGGAAAGGGAAATACTCATGTACAGGTACGGACTCGTTGATGGAACTGAGTACACCCTGGAACAGGTAGGAAAGATGTTTAACGTAACGAGGGAAAGGATAAGACAGATAGAAAACAAAGCCCTCAGGAAGTTAAGACAC
TRN  10010101100011010
NAM  O08348_XANCP/555-608
ASQ  VLAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRH
DSQ  GTGTTGGCCGGCCTGACCCCGCGGGAAGCCAAGGTGCTGCGCATGCGCTTCGGTATCGACATGAACACCGATCACACGCTGGAAGAGGTCGGCAAGCAGTTCGATGTCACGCGTGAGCGGATTCGCCAGATAGAGGCCAAGGCGTTGCGCAAGCTGCGTCAC
TRN  10010111100111011
NAM  HRDB_STRCO/446-499
ASQ  VLDTLSEREAGVVSMRFGLTDGQPKTLDEIGKVYGVTRERIRQIESKTMSKLRH
DSQ  GTTCTCGACACCCTGTCCGAGCGCGAGGCGGGCGTCGTCTCCATGCGCTTCGGACTCACCGACGGTCAGCCGAAGACCCTCGACGAGATCGGCAAGGTGTACGGCGTCACGCGTGAGCGCATCCGCCAGATCGAGTCGAAGACCATGTCGAAGCTGCGTCAC
TRN  11011111101111111
NAM  HRDA_STRCO/331-384
ASQ  VLSTLGERERKVVQLRYGLADGRPRTLEEIGRLFGVTRERIRQIESKTLSKLRD
DSQ  GTGCTCTCCACTCTCGGCGAACGCGAACGCAAGGTCGTCCAGCTCCGCTACGGCCTGGCCGACGGCCGCCCCCGCACCCTGGAGGAGATAGGCCGCCTCTTCGGCGTCACCCGCGAACGCATCCGCCAGATCGAGTCCAAGACCCTCAGCAAACTCCGCGAC
TRN  10010101100011011
NAM  P77840_CHLAU/278-331
ASQ  VLMKLPERERKIIQLRYGLKDGRYRTLEEVGIEFGITRERIRQIEAVALRKLRH
DSQ  GTTTTGATGAAGCTGCCCGAACGCGAGCGGAAGATCATTCAATTGCGCTACGGTCTCAAAGACGGTCGTTACCGCACGCTCGAAGAGGTCGGTATCGAGTTTGGGATTACCCGCGAGCGCATTCGCCAGATTGAAGCAGTTGCCCTTCGCAAGCTCCGCCAT
TRN  11011101101011011
NAM  P71106_CHLAU/281-334
ASQ  ALNELPERERKILQLRYGLIDGQRRTLEEVGATFGITRERTRQIEAEALRRLRH
DSQ  GCTCTGAACGAGCTGCCGGAACGTGAACGCAAGATTCTCCAGTTGCGCTACGGCTTGATTGATGGTCAACGCCGCACCCTCGAAGAGGTTGGGGCAACGTTTGGCATCACGCGCGAACGCACCCGCCAGATCGAGGCCGAAGCGTTACGTCGCCTGCGCCAT
TRN  11011111101111110
NAM  RPOD_BORBU/563-616
ASQ  ILGTLPEREQEVVKMRFGLEDGYSLTLEEVGLHFNVTRERIRQIESKALRRLKN
DSQ  ATTCTTGGAACTCTTCCTGAAAGAGAACAAGAAGTTGTAAAAATGAGATTTGGACTTGAAGATGGCTATTCTTTAACTCTTGAAGAGGTTGGACTTCATTTTAATGTTACAAGAGAAAGAATTAGGCAAATTGAATCTAAAGCATTAAGGCGGCTTAAAAAT
TRN  10010101110011010
NAM  RPOD_TREPA/545-598
ASQ  ILSALPAREHEVLRMRFGLDGDYSQTLEEVGLYFDVTRERIRQIEAKALKRLRH
DSQ  ATCCTCTCCGCTCTTCCTGCGAGGGAGCACGAAGTTTTGAGAATGCGTTTTGGTCTCGATGGAGACTACTCTCAAACGTTGGAAGAGGTCGGTTTGTACTTTGATGTGACGCGTGAGCGTATTCGGCAGATAGAGGCGAAGGCCCTTAAGCGTTTGCGTCAT
TRN  10010101110011011
NAM  Q79VF3_CORGL/266-319
ASQ  VLNTLEPREQDVIRLRYGLDDGVPRTLDQIGRRFGLSRERVRQIEREVMSKLRD
DSQ  GTCCTTAACACTCTCGAGCCACGCGAGCAGGATGTCATCCGTTTGCGCTACGGCCTCGATGACGGTGTGCCACGCACCCTTGATCAGATTGGTCGCCGCTTCGGACTGTCCCGTGAGCGCGTCCGCCAGATAGAGCGTGAAGTCATGAGTAAGCTCCGCGAT
TRN  10010111100111011
NAM  P77906_MYCTU/280-333
ASQ  VLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERDVMSKLRH
DSQ  GTGCTGGCCACTCTCGACGAGCGTGAGCACCAGGTGATCCGGCTGCGCTTCGGCCTGGATGACGGCCAACCACGCACCCTGGATCAAATCGGCAAACTATTCGGGCTGTCCCGTGAGCGGGTTCGTCAGATCGAGCGCGACGTGATGAGTAAGCTGCGGCAC
TRN  11011101101011011
NAM  Q9ZPL2_MAIZE/469-522
ASQ  ALDTLTTREKQVVVLRFGLEDGRIRTLQEIGNIMGVSRERIRQIESGAFRKLRS
DSQ  GCACTAGATACTCTCACCACTCGCGAGAAGCAAGTTGTTGTTCTGAGGTTTGGGCTCGAGGATGGTCGGATAAGAACCCTGCAGGAGATCGGTAACATCATGGGCGTGAGCAGGGAGAGAATCCGGCAGATCGAGTCTGGCGCGTTCCGGAAACTAAGGAGC
TRN  10010101100011011
NAM  O22056_ARATH/504-557
ASQ  VLDSLGTREKQVIRWRFGMEDGRMKTLQEIGEMMGVSRERVRQIESSAFRKLKN
DSQ  GTGTTGGACTCGTTGGGTACAAGGGAGAAACAAGTGATACGTTGGAGATTTGGGATGGAGGATGGGAGAATGAAGACGTTGCAAGAGATAGGAGAGATGATGGGAGTGAGCAGGGAGAGAGTAAGACAGATAGAGTCATCTGCATTCAGGAAACTAAAGAAC
TRN  10010101110011001
NAM  Q9ZPL1_MAIZE/457-510
ASQ  ALDSLSPRKKQVMRYRFGIEGGRARTLHDIGQLMGVSRERIRQIELGAFRKLRS
DSQ  GCGCTGGACAGCCTGAGCCCGCGCAAGAAGCAGGTGATGCGGTACCGGTTCGGCATCGAGGGCGGGCGGGCCAGGACCCTGCACGACATCGGGCAGCTCATGGGGGTCAGCCGGGAGCGGATCCGGCAGATCGAGCTGGGCGCGTTCCGGAAGCTGCGGAGC
TRN  10010101100011011
NAM  P94906_MICAE/311-364
ASQ  LSDVLTEREKDVISLRYGLATSQPYTLEEVGGMFNLSRERVRQIQTKAMRKLRR
DSQ  TTAAGTGATGTTCTCACCGAACGGGAAAAAGATGTTATCTCTCTCCGTTATGGTTTAGCTACCAGTCAACCCTATACCCTAGAGGAAGTGGGGGGAATGTTTAATTTATCTCGCGAACGAGTACGTCAAATTCAAACTAAAGCGATGCGAAAATTACGTCGT
TRN  11011101111011010
NAM  P73710_SYNY3/305-358
ASQ  LAEVLTEREMEVICLRYGIASHQSYTLEEVGNMFNLSRERVRQIQSKAMRKLRR
DSQ  TTGGCCGAGGTACTAACGGAACGGGAAATGGAAGTGATTTGTCTGCGCTACGGCATTGCCAGCCACCAAAGTTACACCCTTGAGGAAGTGGGCAATATGTTTAATCTTTCCCGGGAAAGGGTTAGACAAATCCAAAGCAAAGCCATGCGGAAACTCCGTCGT
TRN  10010101100011011
NAM  P71149_CHLTE/233-286
ASQ  SLSVLAPREADVIRSYFGIGMDNPLTLEEIGEKFKLTRERVRQIKEKAIRRLRQ
DSQ  TCGCTTTCGGTGCTCGCGCCGAGAGAGGCTGACGTCATCCGCTCCTACTTCGGCATTGGCATGGACAATCCGCTCACCCTGGAAGAGATCGGTGAAAAGTTCAAGCTTACTCGCGAGCGAGTCCGCCAGATCAAGGAAAAAGCGATCCGCCGTCTCCGCCAG
TRN  10010101100011011
NAM  O22058_ARATH/505-558
ASQ  LLEGLEPREKQVMVLRYGLQDYRPKSLEEIGKLFKVSKEWIRKIERRAMAKLRD
DSQ  CTTCTAGAAGGGTTAGAGCCAAGAGAGAAGCAAGTGATGGTCCTACGTTATGGTCTTCAAGACTACAGGCCCAAGTCCCTGGAAGAGATTGGGAAGCTTTTTAAAGTTAGCAAAGAATGGATTCGGAAGATCGAACGGAGAGCAATGGCTAAACTCAGAGAC
TRN  10010101100011010
NAM  P77841_CHLAU/245-298
ASQ  ALQQLSPRERSILRLRYGLDGEPMHTLEQIGQRLRLTRERVRQLEHEALRKLRD
DSQ  GCCCTGCAACAGCTTTCGCCGCGCGAACGCAGCATCCTACGCCTGCGCTACGGCCTGGACGGCGAGCCGATGCACACCCTCGAACAGATCGGACAGCGCCTCCGCCTGACCCGCGAGCGCGTGCGCCAGTTGGAACACGAAGCGCTCCGCAAACTGCGCGAT
TRN  11011101101011011
NAM  HRDC_STRCO/274-327
ASQ  AVGTLAPRESLILSLRYGLHDGRPRTLQQVAQHVGLTRERVRQLEKESLAHLRA
DSQ  GCCGTCGGCACCCTCGCACCTCGCGAGTCCCTGATCCTCAGCCTGCGCTACGGGCTGCACGACGGCCGCCCCCGCACCCTGCAACAGGTCGCCCAGCACGTGGGCCTCACCCGCGAACGCGTCCGCCAGCTGGAGAAGGAGTCCCTCGCCCACCTGCGCGCC
TRN  11011111101111111
NAM  P77996_THETU/196-248
ASQ  ILDSLPERERMILKMRFGF-GCNLKTLTEIGNIFGLTRERIRQIQNNTIKELRH
DSQ  ATTTTAGATAGTCTTCCAGAGAGGGAAAGAATGATACTTAAAATGCGATTTGGCTTT---GGCTGTAATTTAAAGACCCTGACGGAGATCGGAAATATCTTTGGACTGACTCGAGAGCGAATACGCCAGATACAGAACAATACCATAAAAGAATTAAGGCAC
TRN  10010101100011010
NAM  Q9ZSL6_ARATH/351-404
ASQ  LLGSLTARESRVLGLYFGLNGETPMSFEEIGKSLKLSRERVRQINGIALKKLRN
DSQ  CTCTTAGGAAGTCTTACCGCTAGAGAATCTCGTGTATTGGGACTTTACTTTGGGCTCAACGGAGAGACTCCTATGTCGTTTGAAGAGATAGGTAAGTCGCTGAAGCTTTCGAGAGAGAGGGTGAGACAAATCAATGGCATTGCTTTGAAGAAGCTACGGAAT
TRN  10010101100011010
NAM  Q9R6V8_SYNP7/256-309
ASQ  LLDQLTEQQRQVIALRYGLEDGQVMTLASIGDRLQISRERVRQLEREALHTLRQ
DSQ  CTCTTGGATCAATTGACTGAGCAACAGCGACAAGTGATTGCCCTGCGCTACGGACTTGAGGATGGCCAGGTGATGACCCTCGCCTCAATTGGCGATCGCCTGCAAATCAGTCGCGAGCGTGTGCGTCAGTTGGAGCGTGAAGCGTTGCATACCCTGCGCCAA
TRN  11011111101111101
NAM  Q9KHE8_ANASP/268-321
ASQ  LMEQLTPQQKEVITLRFGLIDGQALTLARIGEILNISRERVRQIEREALTKLRK
DSQ  CTGATGGAGCAATTAACGCCCCAGCAGAAAGAAGTAATCACACTCCGCTTTGGCTTAATCGATGGGCAAGCCCTAACTCTAGCAAGAATCGGCGAAATACTTAACATCAGCCGCGAACGAGTCAGACAAATCGAAAGAGAAGCGCTTACCAAATTGCGTAAG
TRN  10010101100011010
NAM  P73666_SYNY3/254-307
ASQ  LMAELTPQQREVLILRFGLNDGQPLTLASIGSMLSISRERVRQIEREALNKLRK
DSQ  CTGATGGCGGAATTAACGCCCCAACAACGGGAAGTTCTCATTCTCCGCTTTGGCCTCAATGATGGCCAACCCCTAACCTTGGCGAGCATTGGCTCCATGCTCAGCATCAGTCGGGAACGGGTGCGGCAGATTGAGCGGGAAGCCCTAAATAAATTACGCAAA
TRN  11011101101011010
NAM  P96034_SYNSP/253-306
ASQ  MLNDLTAQQQEVLTLRFGLRDGTPHTLAKIGEHLNISRERVRQIEHGSLAKLRK
DSQ  ATGTTAAATGATTTGACCGCCCAACAACAGGAAGTTTTAACCCTCCGCTTTGGTCTCCGGGATGGGACGCCCCACACCCTCGCAAAAATTGGTGAACATCTGAACATCAGCCGGGAGCGGGTACGTCAAATTGAACATGGAAGCCTCGCTAAACTCCGCAAA
TRN  11011101101011010
NAM  Q9KHE5_ANASP/263-316
ASQ  LLAELTPQQREVVALRFGLLDGNELSLAKVGERLNLSRERVRQLEHQALAHLRR
DSQ  CTCTTGGCAGAACTCACACCCCAACAGCGAGAAGTCGTAGCCTTACGCTTTGGTTTGTTAGACGGTAACGAATTATCCTTGGCGAAAGTCGGTGAACGATTGAACCTCAGTCGTGAACGCGTCCGCCAATTAGAACATCAAGCACTAGCTCATCTGCGTCGC
TRN  11011101101011010
NAM  P96032_SYNSP/263-316
ASQ  LIADLTPQQQEVIILRFGLNDGKELSLAKIGKRMNLSRERVRQLERQALNHLRR
DSQ  CTGATCGCGGATTTGACCCCCCAGCAACAGGAAGTGATTATTCTGCGCTTTGGCCTGAACGATGGCAAAGAACTATCCCTGGCAAAAATTGGCAAACGCATGAACCTCAGTCGGGAACGGGTACGCCAGCTAGAACGCCAGGCTTTGAATCATCTGCGGCGC
TRN  11011101101011011
NAM  Q55525_SYNY3/280-333
ASQ  LLAELTPQQQAVLTMRFGLNDGQELSLAKIGQHLNISRERVRQLENQALAQLKR
DSQ  TTACTGGCGGAATTAACACCCCAGCAACAGGCTGTGCTGACCATGCGTTTTGGTCTTAACGATGGCCAAGAGCTATCTTTGGCTAAAATCGGCCAGCATCTCAACATCAGCCGGGAAAGGGTCCGCCAATTAGAAAACCAAGCCCTTGCGCAACTGAAGCGT
TRN  10010101100011010
NAM  Q55350_SYNSP/256-309
ASQ  LMAELTPQQQAVIALRYGLDEGDSLSLAKVGERLNISRERVRKLERQAMDHLRR
DSQ  TTAATGGCAGAACTGACCCCCCAGCAACAGGCCGTGATTGCCCTGCGCTACGGCTTGGATGAAGGTGACAGTCTGTCGTTGGCCAAAGTCGGCGAACGCCTGAATATCAGCCGCGAACGCGTGCGGAAACTAGAGCGCCAAGCCATGGATCACCTACGTCGC
TRN  11011101101011010
NAM  RPSB_ANASP/268-321
ASQ  LLAKLTPQQKEVLILRFGLAGGCELTLVQISQRMGISRERVRQVEKQALTLLRR
DSQ  CTATTAGCAAAGCTGACTCCCCAGCAAAAAGAAGTCTTAATCTTGCGCTTTGGTTTAGCAGGTGGATGCGAACTGACCCTAGTACAGATTAGTCAACGGATGGGTATTAGTCGGGAACGAGTACGACAAGTGGAAAAACAAGCTCTCACGCTTCTACGAAGA
TRN  10010101100011010
NAM  Q9R6V7_SYNP7/247-300
ASQ  WLAHLTEREQQVLQLRFGLHDGEQHTLAEIGRRLNVSRERIRQVEARALQKLRV
DSQ  TGGTTGGCACACCTGACCGAACGTGAGCAGCAGGTCTTGCAACTGCGCTTTGGTCTCCACGACGGCGAGCAACACACCTTGGCGGAAATTGGTCGGCGGCTGAATGTGTCCCGCGAACGGATTCGTCAAGTTGAAGCTCGGGCACTGCAAAAACTGCGGGTC
TRN  11011101101011011
NAM  Q9FD90_SYNEL/330-383
ASQ  LLLELNHRERDVIRMRFGLRDGQIYSLAEIGQVLDLSRERVRQIEAKALQKLRH
DSQ  TTATTGCTCGAACTCAATCACCGCGAACGCGATGTAATTCGGATGCGGTTTGGTCTGCGCGATGGGCAGATTTATTCCCTCGCTGAAATTGGGCAAGTGCTCGACCTATCGCGTGAGCGAGTTCGCCAGATTGAGGCTAAGGCCCTGCAAAAGCTGCGGCAT
TRN  11011111101111110
NAM  RPSC_ANASP/348-401
ASQ  LLADLTSRERDVILMRFGLADGHPYSLAEIGRALDLSRERVRQIESKALQKLRQ
DSQ  TTATTAGCTGATTTAACTAGCCGTGAACGTGATGTCATCTTGATGCGTTTCGGTTTAGCTGATGGTCATCCTTACTCATTGGCAGAAATTGGCCGCGCTCTGGATTTATCACGGGAGCGAGTACGCCAAATTGAATCTAAGGCCTTGCAAAAACTCCGCCAA
TRN  11011101101011000
NAM  P96035_SYNSP/330-383
ASQ  LLTELTDREREVIQLRYGLGDGKTYSLAEIGRMLDVSRERVRQIEAKALQKLRQ
DSQ  TTACTGACAGAACTCACCGACCGAGAACGGGAAGTCATTCAACTGCGCTATGGTCTAGGCGATGGTAAAACCTACTCCCTCGCAGAGATTGGCCGAATGCTAGACGTTTCGCGGGAACGAGTACGCCAAATTGAGGCAAAGGCCCTCCAGAAACTCCGCCAG
TRN  11011101101011010
NAM  RPSC_SYNY3/336-389
ASQ  ILLDLTPREQEVIALRFGFQDGVAHSLSEIGRILNLSRERVRQIEAKALQKLRH
DSQ  ATTTTGCTAGATTTGACCCCCAGGGAACAGGAAGTAATCGCCCTGCGCTTTGGTTTTCAAGACGGCGTAGCCCACTCCCTATCTGAAATTGGGCGTATTTTGAATTTATCGAGGGAAAGGGTACGACAGATTGAAGCTAAGGCTCTGCAAAAGTTGCGCCAT
TRN  10010101100011010
NAM  Q9LD95_ARATH/479-532
ASQ  LLNVLSPKERRIIKLRFGIDGGKQRSLSEIGEIYGLSKERVRQLESRALYRLKQ
DSQ  CTCCTCAATGTACTGAGTCCAAAGGAGAGAAGGATCATCAAGCTGAGATTTGGGATTGATGGCGGTAAACAGAGATCGTTATCGGAAATAGGAGAGATTTACGGATTGTCAAAGGAGAGGGTAAGGCAGCTAGAGAGCCGGGCATTGTACAGGCTTAAGCAG
TRN  10010101100011000
NAM  O67437_AQUAE/245-298
ASQ  LLSKLTDKERKVIELRFGLKGNEPKTLREIGEILGLSRERVRQLETRALRKLRS
DSQ  CTCCTGAGCAAGCTGACGGATAAAGAGAGGAAGGTAATAGAACTCAGGTTCGGCCTTAAGGGAAACGAACCCAAGACCTTAAGGGAAATAGGTGAGATACTCGGACTCTCCAGAGAAAGGGTAAGACAGTTGGAAACAAGAGCCCTGAGGAAATTGAGAAGT
TRN  10010101100011010
NAM  HRDD_STRCO/268-321
ASQ  LIGRLDPRTASIIKMRYGIDDGRERTLTEVGKEHGLTRERIRQIEKHALLELKK
DSQ  CTCATCGGCCGCCTGGACCCGCGCACGGCCTCCATCATCAAGATGCGGTACGGCATCGACGACGGCCGTGAGCGCACGCTGACCGAGGTCGGCAAGGAGCACGGCCTCACCCGCGAGCGCATCCGCCAGATCGAGAAGCACGCGCTGCTGGAGCTGAAGAAG
TRN  11011111101111111
NAM  Q9S4T1_LEGPN/275-328
ASQ  LLDKLTENQQQVIARRFGLRGFEKATLEDVGKEIDLTRERVRQIQVEALKTLRT
DSQ  CTTCTGGATAAATTAACTGAGAATCAACAGCAGGTTATCGCAAGACGTTTTGGGTTAAGAGGTTTTGAAAAAGCGACACTGGAAGACGTTGGTAAGGAAATTGATTTGACCCGAGAACGCGTTCGCCAAATTCAAGTTGAAGCGTTGAAGACACTTAGAACT
TRN  10010101100011010
NAM  O33503_PSETO/269-322
ASQ  WLSELTDKQREVVIRRFGLRGHESSTLEDVGLEIGLTRERVRQIQVEGLKRLRE
DSQ  TGGCTCTCCGAGCTCACGGACAAGCAGCGTGAAGTGGTGATTCGCCGCTTCGGCCTGCGCGGCCATGAGAGCAGTACCCTGGAGGATGTAGGCCTGGAAATCGGCCTGACCCGCGAGCGGGTGCGGCAGATCCAGGTCGAGGGCCTCAAGCGTTTGCGGGAG
TRN  11011111101111111
NAM  O08372_ENTCL/278-331
ASQ  WLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLRE
DSQ  TGGCTGTTCGAACTGAACGCCAAACAGCGTGAAGTGCTGGCACGTCGTTTCGGTTTACTGGGGTATGAAGCTGCGACACTGGAAGACGTCGGTCGTGAGATTGGCCTGACCCGTGAACGTGTTCGTCAGATTCAGGTTGAAGGACTACGCCGCCTGCGTGAA
TRN  11011101101011010
NAM  Q9KI19_COXBU/285-338
ASQ  WLAQLDERHREVVILRFGLHENEKGTLEAVGKAVGLTRERVRQIQIDALQQLRH
DSQ  TGGTTAGCTCAACTGGATGAACGTCATCGTGAGGTCGTTATTCTGCGTTTTGGCTTGCACGAAAATGAAAAAGGCACGCTCGAAGCAGTGGGTAAAGCGGTGGGATTGACACGCGAACGCGTTCGTCAAATCCAAATAGACGCTCTGCAGCAATTACGCCAC
TRN  10010101100011010
NAM  Q9JP89_RHOGE/256-309
ASQ  GLAELNEREREVLAGRFGLRDREPETLEELAARLGLTRERIRQIQQEALLKLKR
DSQ  GGCCTGGCCGAACTCAACGAGCGCGAGCGCGAGGTGCTCGCCGGCCGCTTCGGCCTGCGCGACCGCGAGCCCGAGACGCTGGAGGAACTGGCCGCGCGCCTGGGTCTGACGCGCGAGCGCATCCGCCAGATCCAGCAGGAAGCGCTGCTCAAGCTCAAGCGC
TRN  11011111101111111
NAM  O52607_RALSO/310-363
ASQ  WLARLSDKHRYVVERRFGLNHIEPATLEELAAEMGLTRERVRQIQQEALVKLKR
DSQ  TGGCTGGCGCGGCTGTCCGATAAGCATCGCTATGTGGTGGAGCGCCGCTTCGGCCTCAACCACATCGAGCCCGCCACCCTCGAAGAGTTGGCGGCCGAGATGGGCCTGACGCGCGAGCGTGTGCGCCAGATCCAGCAGGAAGCGCTGGTCAAGCTCAAGCGG
TRN  11011111101111111
NAM  O83976_TREPA/246-299
ASQ  ILRLLPARDAQVIRYRFGLGGYERRSLQEIGEIFQITKERVRQIEKKALLRIRS
DSQ  ATTTTACGACTTTTGCCTGCGCGTGATGCGCAGGTCATCCGCTATCGATTTGGACTTGGCGGGTATGAACGGCGTTCTCTGCAAGAGATTGGAGAAATTTTTCAGATAACAAAGGAGCGCGTTCGCCAAATAGAAAAAAAGGCTTTGTTGCGTATCCGTAGC
TRN  10010101100011010
NAM  Q9ZNX9_ARATH/452-505
ASQ  VLDSLKPKESLVIRQRYGLDGKGDRTLGEIAGNLNISREMVRKHEVKALMKLKH
DSQ  GTGCTCGATTCATTGAAGCCGAAAGAGAGTCTGGTTATTCGACAGAGGTACGGTCTTGATGGAAAAGGCGACAGGACTCTAGGAGAGATAGCTGGAAATCTCAACATCTCTAGAGAAATGGTTAGGAAACATGAAGTCAAGGCCTTGATGAAGCTTAAGCAT
TRN  10010101100011001
NAM  Q9KDC8_BACHD/172-225
ASQ  YIHVLDDREKEVIVGRFGLDLEEERTQREIAKELGISRSYVSRIEKRALMKLFH
DSQ  TACATTCATGTTCTCGATGACCGGGAAAAGGAAGTGATCGTAGGCAGGTTCGGACTTGACTTAGAAGAGGAACGGACCCAGCGGGAGATTGCCAAAGAACTCGGAATATCGAGAAGTTATGTATCGCGAATTGAAAAACGAGCGCTTATGAAGCTATTTCAT
TRN  10010101110011010
NAM  Q9ZDM4_RICPR/232-283
ASQ  AMQILNDRELRILKDRK-LTDTPK-TLDILSSEYNISKERIRQIENTAFEKIKK
DSQ  GCTATGCAGATTTTAAATGATAGGGAATTACGTATTTTAAAAGATCGTAAA---TTAACAGATACTCCTAAA---ACTCTAGATATTTTAAGCAGTGAGTATAATATTTCGAAGGAACGTATTAGACAAATAGAAAATACAGCTTTTGAAAAAATAAAAAAG
TRN  10010101110011010
NAM  Q9LA67_RHIME/223-274
ASQ  ALGELSEREMKIIRARR-LTEDGA-TLEELGVALGISKERVRQIETRALEKLRA
DSQ  GCGCTCGGAGAGCTCAGCGAGCGTGAAATGAAGATCATTCGCGCCCGCCGC---CTGACGGAGGATGGCGCC---ACGCTGGAGGAGCTCGGCGTCGCGCTTGGAATATCGAAGGAGCGCGTGCGGCAGATCGAGACGCGCGCACTCGAAAAACTTCGTGCG
TRN  10010101100011011
NAM  Q98FA7_RHILO/222-273
ASQ  ALHALNARELRIIEERR-LNDEGA-TLEALGETLGISKERVRQIEARAMEKLKV
DSQ  GCCCTTCACGCGCTCAACGCGCGGGAACTCAGGATCATCGAGGAACGCCGG---CTGAACGACGAGGGCGCC---ACGCTCGAGGCACTCGGCGAGACGCTCGGCATTTCCAAGGAACGCGTCCGCCAGATCGAGGCCCGCGCCATGGAAAAGCTCAAGGTG
TRN  10010101100011011
NAM  Q98FJ9_RHILO/230-281
ASQ  ALAVLNERERRIFEARR-LAEEPL-TLEELSAEFDISRERVRQIEVRAFEKVQD
DSQ  GCTCTTGCCGTGCTCAATGAGCGCGAGCGGCGCATCTTCGAGGCCCGTCGC---CTCGCCGAGGAGCCGCTG---ACGCTGGAAGAGCTCTCGGCCGAGTTCGACATCAGCCGCGAGCGCGTGCGCCAGATCGAGGTGCGCGCCTTCGAGAAGGTGCAGGAT
TRN  11011111101111111
NAM  P94330_BRAJA/230-281
ASQ  AMGVLNPRERRIFEARR-LADEPM-TLEDLAAEFGVSRERVRQIEVRAFEKVQS
DSQ  GCCATGGGCGTGCTCAACCCGCGCGAACGCCGCATCTTCGAGGCCCGCCGC---CTCGCCGATGAGCCGATG---ACGCTGGAAGACCTTGCCGCCGAGTTCGGCGTGTCGCGCGAGCGCGTCCGCCAGATCGAGGTCCGCGCCTTCGAGAAGGTGCAGTCC
TRN  11011111101111111
NAM  P77830_BRAJA/230-281
ASQ  ALANLNARERNIFTARW-LNEEST-TLEELAAEYGVSRERVRQIEERAFQKVKA
DSQ  GCCCTCGCCAACCTCAACGCTCGCGAACGCAACATCTTCACCGCGCGCTGG---CTGAACGAGGAGTCGACG---ACCCTTGAAGAACTTGCCGCGGAATATGGAGTATCCCGCGAACGGGTTCGCCAGATCGAGGAGCGAGCGTTTCAAAAGGTAAAGGCT
TRN  11011111101111111
NAM  P95657_RHOSH/232-283
ASQ  SMSVLNDREKDILVQRR-LTDDPV-TLEELSEGYGVSRERIRQIEVRAFEKLQA
DSQ  TCGATGTCGGTCCTGAACGACCGCGAGAAGGACATTCTCGTGCAGCGCCGC---CTGACCGACGATCCGGTG---ACGCTCGAGGAGCTGTCCGAGGGCTACGGCGTCAGCCGCGAGCGGATCCGCCAGATCGAGGTCCGCGCCTTCGAGAAGCTTCAGGCC
TRN  11011111101111111
NAM  O30806_RHOCA/233-284
ASQ  AMDVLNERERDILMARR-LRDEPV-TLEELSSQYDVSRERIRQIEVRAFEKLQG
DSQ  GCGATGGACGTGCTGAACGAACGCGAACGCGACATCCTGATGGCGCGGCGG---CTGCGCGACGAACCGGTG---ACGCTGGAAGAACTCTCGTCGCAATATGACGTCAGCCGCGAGCGGATCCGGCAGATCGAAGTGCGGGCGTTCGAAAAGCTGCAGGGC
TRN  11011111101111111
NAM  RP32_ZYMMO/235-286
ASQ  AMDRLNDREKHILTERR-LSDNPK-TLEELSQVYGVSRERVRQIEVRAFDKLQK
DSQ  GCGATGGATAGACTGAACGACCGTGAAAAACATATTCTGACAGAAAGACGG---TTAAGCGATAACCCAAAA---ACACTGGAAGAATTAAGTCAGGTCTATGGGGTCAGCCGCGAACGTGTTCGGCAAATTGAGGTGAGAGCCTTCGATAAATTGCAAAAG
TRN  10010101100011010
NAM  RP32_CAUCR/230-281
ASQ  AMVELTDRERHILTERR-LKDDPT-TLEELAAQYGVSRERVRQIEVRAFEKLQK
DSQ  GCGATGGTCGAGCTGACCGACCGCGAGCGTCACATCCTGACCGAGCGCCGC---CTGAAGGACGATCCGACC---ACCCTGGAAGAACTCGCCGCCCAATACGGCGTCAGCCGCGAACGCGTGCGCCAGATCGAGGTCCGCGCGTTCGAGAAGCTGCAGAAG
TRN  11011111101111111
NAM  P94333_BRAJA/239-290
ASQ  ALGGLAARERHVFEARR-LTECPV-TLDQLARELSISSERVRQIEIRAFAKVKR
DSQ  GCGCTGGGCGGGCTTGCGGCGCGGGAACGTCATGTCTTCGAGGCGCGGCGA---CTGACGGAATGCCCTGTG---ACGCTCGATCAGTTGGCCCGCGAATTGTCCATCTCCAGCGAACGGGTTCGACAGATCGAGATTCGTGCCTTTGCCAAGGTCAAGCGG
TRN  11011111101111111
NAM  Q53611_STIAU/224-275
ASQ  ALQRLDPRERFIIEKRV-MSDSEM-TLSELGEHFGFSRERARQLEIRAKDKLKA
DSQ  GCGCTCCAGCGGCTGGACCCGCGCGAGCGCTTCATCATCGAGAAGCGCGTG---ATGAGCGACTCGGAGATG---ACCCTGAGCGAGCTGGGCGAGCACTTCGGTTTCTCGCGTGAGCGGGCCCGCCAGCTGGAGATCCGAGCCAAGGACAAGCTCAAGGCG
TRN  11011111101111111
NAM  RPSB_MYXXA/177-228
ASQ  ALMRLDPREPFIIEQR--VMNERPMTLKELGEHFGFSRERARQLEIRAKDKLKS
NAM  Q9LAQ0_COXBU/232-283
ASQ  AMQSMDDRSRDILYQRW-LSEKKS-TLHELAAQYAVSAERIRQLEKNAMQKIRT
DSQ  GCAATGCAATCGATGGATGATCGAAGTCGAGATATTTTATATCAGCGTTGG---TTAAGTGAAAAAAAATCA---ACGCTTCATGAATTAGCAGCACAATACGCTGTTTCTGCCGAACGTATTCGGCAGCTTGAAAAAAACGCCATGCAGAAAATTCGAACT
TRN  11011101111011000
NAM  Q9KJX7_PSEPU/229-280
ASQ  ALQGLDERSRDILYQRW-LAEEKA-TLHELADKYSVSAERIRQLEKNAMNKVKA
DSQ  GCGCTGCAGGGCCTGGACGAGCGTAGCCGCGACATTCTCTACCAGCGTTGG---CTGGCGGAAGAGAAGGCC---ACGCTGCATGAACTGGCAGACAAGTACAGCGTATCGGCTGAGCGTATTCGCCAGTTGGAGAAGAATGCGATGAACAAGGTCAAGGCA
TRN  11011111101111111
NAM  Q9CKM7_PASMU/226-277
ASQ  ALEGLDERSLDIIKARW-LDENKA-TLQDLAAKYNISAERVRQLETNALKKLKS
DSQ  GCACTTGAGGGACTGGATGAACGTAGTCTTGATATTATTAAAGCGCGTTGG---TTAGATGAAAACAAAGCT---ACTTTGCAAGATTTAGCCGCCAAATACAATATTTCTGCTGAGCGTGTACGCCAATTAGAAACGAATGCACTGAAAAAACTCAAAAGT
TRN  11011101101011010
NAM  Q9JVA9_NEIMA/229-281
ASQ  ALAQLDDRSRRIVESRW-LQDDGGLTLHQLAAEYGVSAERIRQIEAKAMQKLRG
DSQ  GCTTTGGCGCAACTGGATGACAGGAGCCGCCGTATTGTGGAAAGCCGCTGG---CTTCAAGACGACGGCGGGCTGACGCTGCACCAGCTTGCTGCAGAATACGGCGTCTCTGCCGAGCGCATCCGCCAGATTGAAGCAAAAGCCATGCAGAAACTGCGTGGT
TRN  10010101100011011
NAM  O82849_PSEHY/248-299
ASQ  ALTQLDERSRAIVTRRW-LTEKPA-TLHELAAEYGISAERVRQIEAAALKKLRV
DSQ  GCGCTCACGCAGCTCGACGAACGCAGCCGCGCGATCGTCACCCGCCGCTGG---CTCACCGAAAAACCGGCA---ACCCTCCACGAGCTTGCTGCGGAATACGGCATCTCCGCCGAACGGGTGCGGCAGATCGAAGCGGCGGCGCTGAAAAAACTGCGGGTG
TRN  11011101101011011
NAM  Q9ZIL3_MYXXA/212-263
ASQ  FARTLEGKERFIFESRL--VSDEPLTLQDIGDKYGVSRERARQIEAALINRMRD
DSQ  TTCGCCCGGACGCTGGAGGGCAAGGAGCGCTTCATCTTCGAGAGCCGCCTC------GTCTCCGACGAGCCCCTGACGCTCCAGGACATCGGCGACAAGTACGGCGTCAGCCGGGAGCGGGCCCGGCAAATCGAGGCGGCCCTCATCAACCGGATGCGTGAC
TRN  11011111101111111
NAM  Q9Z5S6_ZYMMO/188-237
ASQ  QIKTLPEREALVLQLYY----VEELNLKEIGEVLDLGTARISQIKKSAVDHLRQ
DSQ  CAGATCAAAACTCTGCCAGAGCGGGAGGCCTTGGTTTTACAGCTTTATTAT------------GTCGAAGAATTAAACCTGAAAGAAATCGGGGAAGTGCTTGATCTAGGCACAGCCAGAATTAGCCAAATCAAAAAATCGGCAGTCGATCATTTGCGCCAA
TRN  10010101100011010
NAM  Q9L774_XANOR/186-235
ASQ  AIGQLPEREQLVLSLYY----EQELNLKEIGAVLGVSESRVCQIHGQAVVRLRG
DSQ  GCCATCGGCCAATTGCCCGAGCGCGAGCAGCTGGTGCTGTCGCTGTACTAC------------GAACAGGAATTGAATCTGAAAGAAATCGGCGCCGTGCTCGGTGTCAGCGAATCGCGCGTCTGCCAGATCCACGGCCAGGCGGTGGTGCGTTTGCGGGGC
TRN  11011101101011011
NAM  Q9KQD4_VIBCH/186-235
ASQ  SIKSLPEREALVLSLYY----DEELNLKEIGEVLGVSESRVSQILSQSMQRLRT
DSQ  TCAATAAAATCGCTCCCGGAGCGTGAAGCTTTGGTACTTTCGCTCTATTAT------------GATGAAGAGCTAAACTTAAAAGAAATTGGTGAGGTACTTGGAGTTAGTGAATCTCGCGTCAGCCAGATACTCAGCCAATCTATGCAGCGGCTAAGAACA
TRN  10010101110011000
NAM  FLIA_PSEAE/190-239
ASQ  AIAKLPERERLVLALYY----DEELNLKEIGEVLGVSESRVSQLHSQCAARLRA
DSQ  GCCATCGCCAAGTTGCCGGAGCGCGAGCGCCTGGTGCTGGCGTTGTATTAC------------GACGAGGAACTCAACCTCAAGGAGATCGGCGAGGTACTGGGCGTCAGCGAATCGCGGGTCAGCCAGTTGCACAGCCAGTGCGCCGCGCGTTTGCGCGCG
TRN  11011111101111111
NAM  FLIA_YEREN/175-224
ASQ  AIEALPEREKMVLTLYY----QEELNLKEIGAVLEVGESRVSQLHSQAIKRLRA
DSQ  GCGATCGAGGCTTTGCCGGAACGTGAAAAAATGGTGTTGACGCTGTATTAC------------CAGGAAGAGCTGAACCTGAAAGAAATCGGAGCCGTGCTGGAAGTGGGGGAATCCCGCGTCAGCCAGCTTCATAGCCAGGCGATAAAACGTTTACGCGCC
TRN  10010101100011010
NAM  P77959_STRRP/222-271
ASQ  AINTLPDREKTVVTLYY----YEGLTLAEIGNVLGVTESRVSQIHTKSVLQLRA
DSQ  GCCATCAACACCCTCCCCGACCGCGAGAAGACCGTGGTGACCCTCTACTAC------------TACGAGGGCCTCACCCTCGCGGAGATCGGCAACGTCCTCGGGGTGACCGAGAGCCGGGTCAGTCAGATCCACACCAAGTCCGTGCTCCAGCTCCGGGCG
TRN  11011111111111111
NAM  O83707_TREPA/203-252
ASQ  AIRELSQREQQVLILYY----YEEMTLKEIGKVLKVTESRISQIHTSANLKLKA
NAM  O84064_CHLTR/198-247
ASQ  ALLALDEKERQVMALYY----YDDLVLKEIGKILGVSESRVSQIHSKALLKLRG
DSQ  GCTTTGCTGGCTCTTGATGAAAAAGAGCGGCAGGTTATGGCTCTTTATTAC------------TATGATGACTTGGTATTAAAAGAAATTGGGAAGATTTTAGGAGTGAGCGAGTCCCGAGTTTCTCAGATACACTCCAAAGCTTTATTGAAGTTACGAGGT
TRN  10010101100011010
NAM  Q97H70_CLOAB/184-233
ASQ  GIELLNEKDRMVLSLYY----YEGLTLKKIGNILNVSESRVCQLHTRAIMHLRK
DSQ  GGAATAGAACTTCTTAATGAGAAAGATAGAATGGTATTATCACTATATTAC------------TATGAAGGATTGACTTTAAAGAAAATAGGAAATATTTTAAATGTGTCTGAATCTAGAGTTTGTCAGCTTCATACTAGAGCTATAATGCACCTTAGAAAA
TRN  10010101110011000
NAM  Q9X004_THEMA/162-211
ASQ  AIEKLSDKEKLVLSLRF----EKGLSLKEIARVLGVSESRVSQIISKSLLKIKK
DSQ  GCAATAGAAAAACTTTCGGACAAAGAAAAACTGGTTCTGTCTCTCAGATTC------------GAAAAGGGTCTATCTTTGAAGGAGATAGCGAGAGTGCTCGGTGTATCCGAATCCCGTGTTTCTCAGATTATAAGTAAGTCCCTTCTGAAAATAAAGAAA
TRN  10010101100011011
NAM  Q9AES5_AERHY/181-230
ASQ  VLTSLDKREQLLLSLYY----QQELNMKEIALVLGLTESRVCQLHKQCVLQLKQ
DSQ  GTGCTCACCTCATTGGACAAGCGAGAGCAACTGCTGCTCTCACTCTATTAC------------CAGCAAGAGTTGAATATGAAAGAGATCGCGCTGGTGTTGGGCCTGACCGAATCACGAGTCTGCCAATTGCACAAACAGTGCGTCCTTCAGCTCAAGCAG
TRN  11011101101011001
NAM  O67268_AQUAE/181-230
ASQ  AVSKLPEREKLVIQLIF----YEELPAKEVAKILETSVSRVSQLKAKALERLRE
DSQ  GCGGTTTCAAAACTTCCCGAAAGAGAAAAACTCGTCATTCAATTGATTTTT------------TACGAAGAACTTCCCGCAAAGGAAGTTGCAAAAATTCTCGAAACCTCCGTTTCCCGTGTCTCTCAACTGAAGGCAAAAGCCCTAGAACGCTTAAGGGAA
TRN  10010101100011000
NAM  O25676_HELPY/199-248
ASQ  ALNQMSEREQILIQLYY----FEELNLSEIKEILGITESRISQIIKEVIKKVRK
DSQ  GCGCTGAATCAAATGAGCGAAAGAGAGCAAATCCTTATCCAGCTTTATTAC------------TTTGAAGAGTTGAATTTGAGCGAGATTAAAGAGATTTTAGGCATTACTGAATCGCGCATTTCTCAAATCATTAAAGAAGTGATTAAAAAGGTGCGTAAA
TRN  10010101100011010
NAM  Q9ZIV9_9ACTO/288-337
ASQ  LLRQLDDRERAIVRMRF----GQEMTQAQIGAELGVSQMHVSRLLSRIVRRLRT
DSQ  CTGCTACGGCAGCTGGACGACCGCGAGCGGGCCATCGTGCGGATGCGGTTC------------GGCCAGGAGATGACCCAGGCCCAGATCGGCGCGGAGCTCGGCGTCTCGCAGATGCACGTCTCGCGGCTGCTCAGCAGGATCGTGCGGCGGCTGCGCACG
TRN  10010101100011011
NAM  Q9X7S2_STRCO/237-286
ASQ  LMAELSERDRQIIHLRF----VEEATQAEIGERLGCSQMHVSRLIKRIITRLRE
DSQ  CTGATGGCCGAGCTGAGCGAGCGGGACCGGCAGATCATCCACCTGCGGTTC------------GTGGAGGAGGCCACCCAGGCGGAGATCGGCGAACGGCTCGGCTGCTCGCAGATGCACGTGTCCCGGCTGATCAAGCGGATCATCACCCGGCTGCGCGAG
TRN  11011111101111111
NAM  Q9RIS5_STRCO/249-298
ASQ  LIAELPSRDRKILSLRF----VAGMTQSEIGEELGISQMHVSRLLSRTLVRLRK
DSQ  CTGATCGCCGAGCTGCCCTCCCGGGACCGGAAGATCCTCTCCCTGCGTTTC------------GTCGCCGGCATGACCCAGTCGGAGATCGGCGAGGAGCTGGGCATCTCCCAGATGCACGTCTCGCGTCTGCTGTCGCGGACCCTCGTACGGCTGCGCAAG
TRN  11011111101111111
NAM  Q9ADM4_STRCO/264-313
ASQ  LLAKLPPRERRIIMLRF----FANMTQSQIGEEVGISQMHVSRLLTRTLSQLRE
DSQ  CTGCTGGCCAAGCTGCCGCCCCGGGAGCGGCGGATCATCATGCTGCGCTTC------------TTCGCCAACATGACGCAGTCGCAGATCGGCGAGGAGGTCGGCATCTCGCAGATGCACGTCTCCCGGCTGCTCACCCGGACCCTGTCGCAGCTGCGCGAG
TRN  11011111101111111
NAM  Q9K4K0_STRCO/222-271
ASQ  GLRRLPERERAILYMRF----FEDMTQSRIADCLGISQMHVSRLISRSCARVRD
DSQ  GGCCTGCGCAGGCTGCCCGAACGGGAGCGCGCCATCCTCTACATGCGCTTC------------TTCGAGGACATGACGCAGAGCCGGATCGCCGACTGCCTGGGCATCTCGCAGATGCACGTCTCGCGGCTCATCAGCCGCAGCTGCGCCCGCGTCCGTGAC
TRN  10010101100011011
NAM  O86702_STRCO/207-256
ASQ  RLAALPPRERAILYMRF----FNDMTQSRIAEQLGISQMHVSRLITRCCDRVRE
DSQ  CGGCTGGCCGCCCTGCCTCCGCGCGAGCGCGCCATCCTGTACATGCGCTTC------------TTCAACGACATGACCCAGAGCCGTATCGCGGAGCAGCTCGGCATCTCCCAGATGCACGTCTCCCGCCTGATCACCCGCTGCTGCGACCGGGTGCGGGAA
TRN  11011111101111111
NAM  O52313_STRCO/207-256
ASQ  CLEALPERERTILYLRF----FGGMTQSRIAQQLGISQMHVSRLLTGCFDRIRE
DSQ  TGCCTGGAGGCACTTCCCGAGCGCGAACGCACCATCCTCTACCTGCGCTTC------------TTCGGAGGGATGACCCAGAGCCGCATCGCCCAGCAGCTCGGCATCTCGCAGATGCACGTCTCCCGGCTGCTCACCGGCTGCTTCGACCGGATACGTGAG
TRN  10010111100111011
NAM  Q9K9T9_BACHD/178-231
ASQ  ALHTLTDREKQIMELRFGLAGGEEKTQKDVADLLGISQSYISRLEKRIIKRLQK
DSQ  GCTTTACATACGTTAACCGATCGGGAGAAGCAAATTATGGAACTCCGCTTCGGCTTAGCGGGAGGGGAGGAAAAAACGCAAAAAGATGTAGCTGACCTTCTTGGAATTTCACAATCGTATATCTCTCGATTAGAGAAGCGAATCATCAAACGGCTGCAAAAA
TRN  11011101101011000
NAM  RPSE_CLOAB/176-229
ASQ  ALKKLNEREKRIVELRYGLTGVGEKTQKEVADMLGISQSYISRLEKRIIKRLKK
DSQ  GCTCTTAAAAAGTTAAACGAAAGAGAAAAAAGAATAGTTGAATTAAGATATGGACTTACAGGCGTTGGAGAAAAAACTCAAAAGGAAGTTGCAGATATGCTGGGTATATCTCAATCCTATATTTCAAGGCTTGAAAAGAGAATAATTAAGAGATTAAAAAAA
TRN  10010101100011000
NAM  P70879_BACCO/199-248
ASQ  AIRGLEERERLIVYLRY----YKDQTQSEAGERLGISQVQVSRLEKKILRVMKE
DSQ  GCGATCAGAGGGCTTGAGGAACGCGAAAGGCTGATTGTGTACCTCCGCTAT------------TACAAAGACCAGACACAGTCCGAAGCTGGCGAACGGCTTGGCATTTCGCAGGTGCAGGTTTCACGGCTTGAAAAGAAAATACTTCGAGTGATGAAAGAG
TRN  10010101100011001
NAM  RPSF_BACLI/199-248
ASQ  AIKDLDEREKLIVYLRY----YKDKTQSEVADRLGISQVQVSRLEKKILKQIKN
DSQ  GCCATCAAGGATTTGGATGAACGGGAAAAGCTGATTGTTTATTTAAGGTAT------------TACAAAGACAAGACGCAATCTGAAGTTGCCGACCGCCTCGGCATATCCCAGGTGCAAGTCTCGAGGCTTGAGAAAAAGATTTTAAAGCAAATCAAAAAC
TRN  10010101100011010
NAM  O32725_BACSH/197-246
ASQ  VLTRLEPREQSIIYLRY----FSDCTQTEIANRLGISQVQVSRLEKKILAQLKS
DSQ  GTGCTTACAAGGCTTGAACCGAGAGAACAGTCTATCATTTATTTACGGTAT------------TTTTCAGATTGCACGCAAACTGAAATTGCAAATAGGCTAGGCATATCACAGGTGCAAGTATCCCGTTTGGAGAAAAAAATTCTAGCTCAATTAAAAAGC
TRN  10010101110011000
NAM  Q9KFF0_BACHD/202-251
ASQ  AFQVLDEREKQILLCTY----FEHLSQKETGHRLGISQMHVSRLQRRALKKLRD
DSQ  GCGTTTCAAGTGTTAGATGAGCGGGAGAAGCAAATTTTGCTTTGTACGTAC------------TTTGAGCATTTGAGTCAAAAGGAGACAGGACACCGTTTGGGGATTTCACAAATGCATGTTTCTCGATTACAGCGACGCGCCTTAAAAAAACTACGCGAC
TRN  11011101111011000
NAM  Q99SI8_STAAN/203-252
ASQ  ILPILSDREREIIQCTF----IEGLSQKETGERIGLSQMHVSRLQRTAIKKLQE
DSQ  ATATTACCTATATTATCTGATCGCGAACGAGAAATCATACAATGTACGTTT------------ATTGAAGGATTGAGTCAAAAAGAGACAGGTGAGCGTATCGGTTTAAGTCAAATGCATGTATCACGACTTCAGAGAACGGCAATTAAGAAATTACAAGAA
TRN  10010101110011000
NAM  O85017_LISIN/202-251
ASQ  VLPVLDEREQKILQYTF----IENRSQKETGELLDISQMHVSRIQRQAIKKLRE
DSQ  GTTCTCCCTGTTTTAGATGAGCGAGAACAGAAAATATTGCAATATACATTC------------ATTGAAAATCGTAGTCAAAAAGAAACTGGTGAACTACTCGATATATCACAAATGCATGTGTCTAGAATCCAACGTCAAGCTATTAAAAAACTTCGAGAG
TRN  10010101110011000
NAM  O50232_BACLI/204-253
ASQ  VLHVLSDREKQIIELTY----IQNKSQKETGDMLGISQMHVSRLQRKAVKKLRE
DSQ  GTATTGCACGTACTGTCCGACCGCGAAAAGCAAATCATTGAGCTGACTTAC------------ATTCAAAACAAAAGCCAAAAAGAAACCGGTGACATGCTGGGCATATCGCAAATGCACGTCTCACGTCTGCAGCGCAAAGCTGTCAAAAAGCTGCGGGAA
TRN  10010101100011001
NAM  RPSB_BACAN/202-251
ASQ  IFNVLNETEKSVIHYIF----EENLNQKDTGERLGISQMHVSRIKRQAISKLKQ
DSQ  ATTTTTAACGTATTAAATGAAACGGAAAAGAGTGTTATTCATTATATATTT------------GAAGAAAATTTAAATCAAAAAGATACAGGGGAACGGTTAGGTATTTCACAAATGCACGTTTCTCGTATTAAAAGACAAGCGATAAGTAAGTTGAAACAA
TRN  10010101110011000
NAM  Q9X6P9_LEPIN/119-168
ASQ  SVESLPQLEKNIIVLRF----LRKYTIKETADKLGISVRTVNRKTFATLTVLRK
DSQ  AGTGTAGAAAGTCTACCTCAGTTGGAAAAAAATATAATTGTACTGCGTTTT------------TTAAGGAAATATACGATCAAAGAGACCGCCGATAAATTGGGAATATCAGTGAGAACGGTAAATAGAAAAACATTCGCCACACTCACCGTTTTACGTAAG
TRN  10010101100011000
NAM  O34843_BACSU/132-181
ASQ  AIQKLTDKQKSVLTKVY----LHGATMQEIADSLGESRQNISNIHKKGLENIRK
DSQ  GCGATCCAGAAGCTGACTGACAAACAAAAAAGTGTGCTGACGAAAGTCTAT------------CTTCACGGTGCCACGATGCAGGAGATTGCAGATTCATTAGGGGAGTCCCGACAAAACATCTCCAACATTCATAAAAAGGGGCTGGAGAATATCAGAAAG
TRN  10010101100011000
NAM  Q9XCD8_MYCSM/141-190
ASQ  ALQALPEEFRMAVYYAD----VEGFPYKEIAEIMETPIGTVMSRLHRGRRQLRD
DSQ  GCGTTGCAAGCTCTTCCAGAAGAGTTCCGGATGGCGGTGTACTACGCCGAC------------GTCGAAGGGTTCCCGTACAAGGAGATCGCCGAGATCATGGAAACGCCCATCGGGACCGTGATGTCCCGTCTGCACCGCGGCCGCAGGCAGCTGCGCGAT
TRN  10010101100011011
NAM  O68520_MYXXA/129-178
ASQ  AIDALPIDFRLVVILAD----LQEFSYKEIAEILECPVGTVMSRLFRGRKLLQK
DSQ  GCCATTGACGCGCTGCCCATCGACTTCCGGCTGGTGGTCATCCTCGCGGAC------------CTCCAGGAGTTCTCCTACAAGGAGATCGCGGAGATTCTCGAGTGCCCCGTGGGCACGGTCATGAGCCGCCTGTTCCGCGGACGCAAGCTCCTGCAGAAG
TRN  11011111101111111
NAM  Q9X1T4_THEMA/130-178
ASQ  ALEKLSPEDRLLIKLRD----IDGLSYEEIASVLQKPVGTVKSRLHYARKRLG-
DSQ  GCTCTGGAAAAGCTCTCACCGGAGGACAGGCTGCTCATAAAACTGAGGGAT------------ATAGACGGGTTGAGCTATGAAGAAATAGCGTCCGTTTTGCAAAAACCTGTTGGAACTGTAAAAAGCCGTCTTCACTACGCAAGAAAGAGGCTGGGA---
TRN  10010101100011001
NAM  Q9RKI2_STRCO/138-187
ASQ  ALGALPDKHRQVVQLVD----IDGLTYAEAAHLLDVPEGTVMSRLHRARKRIRA
DSQ  GCCCTGGGTGCGCTGCCGGACAAGCACCGTCAGGTGGTGCAGCTGGTGGAC------------ATCGACGGCCTCACCTACGCGGAGGCCGCCCACCTGCTGGATGTCCCCGAGGGAACCGTGATGAGCCGGCTGCACCGGGCGCGCAAACGGATACGGGCG
TRN  10010101100011011
NAM  Q9KIN1_PSEFL/20-69
ASQ  AFDQLNTEQRALLLWVS----VEGLSYKDVADILDVPVGTVMSRLSRARQALRQ
DSQ  GCCTTCGATCAACTCAACACCGAACAGCGCGCCCTGCTGTTATGGGTGTCG------------GTCGAAGGTCTGAGCTACAAGGACGTCGCCGACATCCTCGACGTGCCAGTGGGCACCGTGATGTCGCGCCTGTCCCGGGCACGCCAAGCCTTGCGTCAA
TRN  11011111101111110
NAM  Q9EXR8_BRAJA/106-155
ASQ  KLARLPQEQRAVLLLVA----VEDLSYAAAADVLNVPVGTVMSRLSRARERLLQ
DSQ  AAGCTTGCGAGACTGCCGCAGGAGCAGCGGGCTGTGTTGTTGCTTGTTGCA------------GTCGAGGATCTTTCCTACGCCGCCGCCGCGGACGTGTTGAACGTCCCGGTCGGGACAGTGATGTCGCGCCTGTCGCGTGCGCGGGAGCGGCTGCTGCAG
TRN  10010101100011011
NAM  O86856_STRCO/135-183
ASQ  ALGTLPADQRAAFVFVD----MQGYPVAEAARILDVPAGTIKSRCARGRARLL-
DSQ  GCCCTGGGTACCTTGCCCGCCGACCAGCGAGCCGCTTTCGTCTTCGTCGAC------------ATGCAGGGCTACCCCGTCGCGGAGGCCGCCCGCATCTTGGACGTACCGGCCGGAACGATCAAGAGCCGCTGCGCCCGGGGCAGAGCCCGGCTCCTT---
TRN  10010101100011011
NAM  Q9WWP4_SYNP2/141-190
ASQ  GLQSLSLEHRAVLVLHD----LKDLPQKEVAEILGIPPGTVKSRLHHARRSLRQ
DSQ  GGTTTGCAATCGCTAAGCTTGGAACACCGGGCGGTCTTGGTGCTCCATGAT------------CTCAAGGATCTGCCCCAAAAGGAGGTGGCTGAAATTCTTGGGATTCCGCCAGGAACGGTGAAATCTCGCCTCCACCATGCCCGACGATCGCTGCGTCAG
TRN  11011101101011011
NAM  P73744_SYNY3/126-175
ASQ  GLATLSFEHRTVLVLHD----LEDLPQKTIAEVLNLPGGTIKSRLFYARRAMRE
DSQ  GGCTTGGCTACCCTCAGCTTTGAGCATCGCACGGTGTTGGTGCTCCACGAT------------CTGGAGGATTTGCCCCAAAAGACCATTGCGGAGGTACTAAATTTGCCTGGGGGTACTATCAAATCCCGTTTATTCTATGCTCGGCGGGCCATGCGGGAA
TRN  11011101101011010
NAM  Q9L1Z6_STRCO/151-200
ASQ  GLDELPDAQRQVLVLRF----YADLPVRGIAEELGIPEGTVKSRLHTAVRALRA
DSQ  GGCCTGGACGAGCTGCCCGACGCCCAGCGCCAGGTCCTCGTCCTGCGCTTC------------TACGCCGATCTTCCGGTGCGCGGCATCGCCGAGGAGCTGGGCATCCCCGAGGGCACGGTCAAGAGCAGGCTGCACACGGCGGTACGGGCCCTGCGCGCC
TRN  10010101100011011
NAM  O53798_MYCBO/119-168
ASQ  ALAQLSAEHRAVIQRSY----YRGWSTAQIATDLGIAEGTVKSRLHYAVRALRL
DSQ  GCGCTGGCCCAACTGTCCGCCGAGCATAGGGCCGTGATCCAGCGGTCCTAC------------TACCGCGGATGGTCGACCGCACAGATTGCCACCGACCTCGGAATTGCCGAAGGAACGGTGAAGTCGCGATTGCACTACGCCGTGCGCGCGTTGCGGCTC
TRN  10010101100011011
NAM  Q9RCH4_AZOVI/135-184
ASQ  TIQQLPEDLRTALTLRE----FDGLSYEDIASVMQCPVGTVRSRIFRAREAIDK
DSQ  ACCATTCAGCAGTTGCCGGAGGACTTGCGTACGGCGCTGACGCTACGCGAG------------TTCGATGGATTGAGTTACGAAGATATTGCCAGCGTCATGCAATGTCCGGTTGGAACCGTGCGTTCACGCATTTTTCGGGCGCGTGAAGCGATAGATAAA
TRN  10010101100011001
NAM  Q9KPA6_VIBCH/135-184
ASQ  AIDALPDDLKTAMTLRE----LDGLSYEEIAEVMDCPVGTVRSRIFRAREAVEK
DSQ  GCAATTGATGCGTTACCGGATGATTTAAAAACGGCAATGACGTTGCGCGAG------------CTTGATGGCTTGAGTTACGAGGAAATTGCGGAAGTGATGGATTGCCCTGTTGGTACGGTGCGTTCACGAATTTTCCGCGCTCGTGAGGCGGTAGAGAAG
TRN  11011101111011000
NAM  P73431_SYNY3/166-215
ASQ  AIKDLPEAFRTTIILRE----IDGLAYEEIAEITGVSLGTVKSRIARARAKLQT
DSQ  GCCATTAAGGACCTACCTGAAGCTTTCCGCACCACCATTATCCTGCGGGAA------------ATTGACGGTTTAGCCTACGAAGAAATTGCCGAAATCACCGGGGTTTCCCTCGGGACGGTTAAATCTCGCATTGCCCGGGCCCGGGCGAAGTTGCAAACT
TRN  11011101101011010
NAM  Q9KG50_BACHD/133-182
ASQ  EIQALPPKYRMAVLLKY----MEDLSLKEISDILDLPVSTVKTRIHRGREALRK
DSQ  GAAATCCAAGCGTTGCCACCAAAATATCGAATGGCTGTCCTTTTGAAATAC------------ATGGAAGATCTATCGTTGAAGGAGATCAGTGACATTCTTGATTTGCCTGTATCCACAGTCAAGACGAGAATCCACCGCGGTCGTGAAGCGCTGAGAAAG
TRN  10010101100011011
NAM  SIGW_BACSU/133-182
ASQ  KILKLPDKYRTVIVLKY----IDELSLIEIGEILNIPVGTVKTRIHRGREALRK
DSQ  AAAATTTTAAAGCTTCCTGACAAATACAGAACAGTCATCGTATTAAAGTAT------------ATTGACGAACTCTCATTAATTGAAATCGGGGAGATTCTAAACATTCCTGTGGGGACTGTGAAAACGCGGATTCACAGAGGCAGAGAGGCTCTTAGAAAA
TRN  10010101110011000
NAM  Q97E49_CLOAB/131-180
ASQ  SIKKLTYDYRMVIMLRY----YEDLSYDEIASVLDMPIGTVKTKIYRAKNVLKK
DSQ  AGTATAAAAAAGCTTACATATGACTATAGAATGGTAATCATGCTTAGATAT------------TATGAAGATTTAAGCTATGATGAAATTGCTAGTGTATTAGATATGCCTATAGGAACTGTGAAGACTAAAATTTATAGGGCAAAAAATGTTTTGAAGAAA
TRN  10010101110011010
NAM  Q98CJ9_RHILO/127-176
ASQ  FIDALPEEHRTVIDLAY----YHGQSVTEIGEVLAIPVATVKTRMFYARKKLGE
DSQ  TTCATCGACGCCTTGCCGGAAGAACACCGCACGGTGATCGACCTTGCCTAC------------TATCACGGACAGTCGGTGACCGAGATCGGCGAGGTTCTCGCCATACCGGTCGCGACGGTCAAGACCCGGATGTTCTACGCCCGCAAGAAACTCGGCGAG
TRN  10010101110011011
NAM  Q9RXX5_DEIRA/171-219
ASQ  ALMRLAPEYREAVVLRF----VEDLTYDEIARLQGVATGTAKSRVFRAKEQLA-
DSQ  GCGCTGATGCGGCTCGCCCCCGAGTACCGCGAGGCGGTGGTGCTGCGCTTC------------GTGGAAGACCTGACCTACGACGAAATTGCCCGCCTTCAGGGCGTCGCCACCGGCACCGCCAAGAGCCGCGTCTTCCGCGCCAAAGAGCAACTCGCT---
TRN  11011101101011011
NAM  O83130_TREPA/103-152
ASQ  ALDRLPEHLRVVLQLRE----YGDLNYKEIGRILGISEGNVKVRVFRARERLAK
DSQ  GCCTTAGATCGACTGCCCGAGCACCTCCGTGTGGTTTTGCAGTTGCGCGAG------------TATGGGGACTTAAACTACAAGGAGATCGGACGTATCCTGGGCATCAGCGAGGGGAATGTAAAGGTGAGGGTGTTCAGAGCGCGCGAACGATTAGCGAAG
TRN  10010101100011010
NAM  Q983W6_RHILO/124-173
ASQ  ATDSLPDIYRMVFVARV----IEGLSMEETADLLGVRPETVKTRLHRARALLRK
DSQ  GCGACCGACAGCCTGCCCGACATCTACCGCATGGTCTTCGTGGCCCGCGTC------------ATCGAAGGCCTGAGCATGGAGGAAACCGCCGATCTGCTCGGCGTACGGCCGGAGACCGTCAAGACGAGGCTGCACCGGGCGCGTGCCTTGCTGCGCAAG
TRN  10010101100011011
NAM  O68887_STRAT/108-157
ASQ  AMKVLAPKQRSVVVLRH----WEQMSTEETAAALGMSAGTVKSTLHRALARLRE
DSQ  GCGATGAAGGTGCTCGCTCCCAAGCAGCGCAGTGTCGTCGTCCTGCGACAC------------TGGGAGCAGATGTCCACGGAGGAGACGGCCGCCGCCCTCGGCATGTCGGCGGGTACGGTCAAGAGCACGCTGCACCGGGCGCTCGCCCGGCTCCGCGAG
TRN  11011111101111111
NAM  CARQ_MYXXA/114-163
ASQ  ALQQLHPDHREAVVLSK----VEGWSFEEIGALRGISPGAARLRAHRGYEKLRE
DSQ  GCCTTGCAACAACTCCACCCGGACCACCGTGAAGCCGTGGTGCTCAGCAAG------------GTGGAGGGCTGGTCCTTCGAGGAGATTGGCGCGCTGCGGGGCATCAGCCCTGGCGCCGCGCGGCTGCGAGCGCACCGGGGCTACGAGAAGCTGCGCGAG
TRN  11011111101111111
NAM  O05735_MYCAV/186-235
ASQ  ALDSLPPEFRAAVVLCD----IEGLSYEEIGATLGVKLGTVRSRIHRGRQALRD
DSQ  GCGCTGGACTCGCTGCCGCCGGAGTTCCGCGCCGCGGTCGTGCTGTGCGAC------------ATCGAGGGCCTGTCGTATGAGGAGATCGGCGCGACGCTGGGGGTGAAGCTGGGCACCGTGCGCAGCCGCATCCACCGCGGCCGCCAGGCCCTGCGCGAT
TRN  11011111101111111
NAM  Q9K7J9_BACHD/126-175
ASQ  AVFSLPLSYREVIYFYY----YEELSVKEVASFTGLNENTVKTRLRKGRLLLKN
DSQ  GCTGTTTTTTCGTTGCCCCTTTCGTACCGAGAAGTCATTTATTTCTACTAT------------TACGAGGAACTGTCGGTTAAGGAAGTGGCAAGCTTTACAGGACTTAACGAAAATACAGTTAAGACACGGTTAAGAAAAGGACGGTTGCTTTTGAAAAAT
TRN  10010101100011010
NAM  O85900_SPHAR/123-172
ASQ  ALESLPAHYLEVILLRD----FEELTIAEIAGRLHEPAGAIKSRLHRARALVRE
DSQ  GCGCTGGAATCGCTGCCGGCGCACTACCTCGAGGTGATCCTGCTGCGCGAT------------TTCGAGGAACTGACGATCGCCGAGATCGCCGGGCGGCTCCATGAGCCGGCAGGGGCGATCAAGAGCCGCCTGCACCGCGCCCGCGCGCTGGTGCGCGAA
TRN  11011111101111111
NAM  SIGV_BACSU/109-158
ASQ  ALDELPYRYKTIIILRF----FEDLKLEEIAEITGENTNTVKTRLYRALKLMRI
DSQ  GCGCTTGACGAATTGCCGTACCGCTATAAAACCATTATTATTTTACGTTTT------------TTTGAAGACCTCAAATTAGAAGAAATTGCGGAAATTACAGGAGAAAACACGAATACCGTCAAAACGCGCCTATACAGAGCATTGAAGCTGATGCGCATT
TRN  10010101100011010
NAM  Q9R393_PSESX/129-178
ASQ  AIDCLPSNMQKVLEVSL----EMDGNYQETANSLGVPIGTVRSRLSRARVQLKQ
DSQ  GCCATTGATTGCCTGCCGTCGAACATGCAAAAAGTGCTGGAAGTGTCGCTG------------GAGATGGACGGCAATTATCAGGAAACAGCGAACAGCCTCGGCGTGCCGATTGGCACCGTTCGCTCACGCCTGTCCCGCGCGCGGGTTCAGCTCAAGCAG
TRN  11011101101011001
NAM  Q9L1U1_STRCO/136-185
ASQ  ALDDLTPAHREVLVETY----FKGRTVNEAAQTLGIPSGTVRSRVFYALRSMKL
DSQ  GCGCTCGACGACCTGACCCCGGCCCACCGGGAGGTCCTCGTCGAGACGTAC------------TTCAAGGGGCGTACCGTCAATGAGGCGGCGCAGACACTGGGCATACCCAGCGGAACCGTTCGCTCCCGGGTGTTCTACGCCCTGCGTTCGATGAAGCTG
TRN  10010111100111011
NAM  Q9S2A7_STRCO/130-179
ASQ  CLDRLTALQRQSVTLAY----YDGYTYREVAERLSLPLGTVKTRMRDGLGRLRE
DSQ  TGCCTGGACCGCCTGACCGCGTTGCAGCGCCAGTCGGTCACCCTCGCCTAC------------TACGACGGCTACACCTACCGGGAGGTCGCCGAGCGACTCTCCCTGCCGCTGGGCACGGTGAAGACCCGGATGCGGGACGGGCTGGGCCGCCTGCGCGAG
TRN  11011111101111111
NAM  O53730_MYCTU/133-182
ASQ  CLKALTDTQRQCIELAY----YGGLTYVEVSRRLAANLSTIKSRMRDALRSLRN
DSQ  TGCCTCAAGGCGTTGACCGACACGCAGCGGCAGTGCATCGAACTGGCCTAC------------TACGGCGGGCTGACGTATGTCGAAGTTTCGCGGCGGTTAGCGGCCAATCTGTCGACCATCAAATCCCGCATGCGCGACGCCCTGCGCAGCCTGCGCAAC
TRN  11011101101011010
NAM  Q55192_SYNY3/129-178
ASQ  ALETLPPNQRQVLELAY----YEGLSQSEITQKLAIPLGTVKTRSRQGLLKLKN
DSQ  GCCTTGGAGACTTTGCCCCCTAACCAAAGGCAGGTGTTGGAGCTGGCTTAC------------TATGAAGGGCTGAGTCAGTCGGAAATTACCCAAAAATTAGCCATTCCCCTTGGTACGGTTAAAACCCGTTCCCGTCAGGGGTTATTAAAGCTAAAAAAT
TRN  10010101100011010
NAM  Q9RI52_STRCO/141-190
ASQ  ALSRLPQAQRDVLCMAF----YEDLTQAQIAERTGVPLGTVKSHARRGLHRLRT
DSQ  GCCCTGTCCCGATTGCCGCAGGCCCAGCGGGATGTGCTGTGCATGGCCTTC------------TACGAGGACCTGACGCAGGCGCAGATCGCGGAACGCACGGGGGTTCCCCTGGGCACGGTCAAGAGCCACGCCCGCCGCGGCCTGCATCGGCTGCGCACG
TRN  11011111101111111
NAM  Q984A3_RHILO/162-211
ASQ  ALDLLPRDQADILKMSF----YGEVTQSEIANAVGIPLGTVKSRVRLALGRLRQ
DSQ  GCGCTCGATCTTCTGCCGCGAGATCAGGCCGATATCCTGAAAATGTCCTTC------------TATGGCGAGGTAACGCAATCCGAGATCGCCAACGCGGTCGGCATCCCGCTCGGCACCGTTAAATCACGCGTGCGGCTGGCCCTTGGCCGGCTGCGCCAA
TRN  11011101101011001
NAM  Q9AAF3_CAUCR/146-195
ASQ  AMQTLNPDQSQAIEMAF----FQEQTHSQISEALGVPLGTVKARIRFGMMKLRA
DSQ  GCCATGCAAACCCTCAATCCCGATCAATCCCAAGCAATCGAAATGGCCTTC------------TTCCAGGAACAGACCCACAGTCAGATTTCCGAGGCGCTGGGCGTGCCCCTGGGTACGGTCAAGGCTCGGATCCGCTTTGGCATGATGAAGCTGCGCGCC
TRN  11011111101111111
NAM  Q9KPR4_VIBCH/138-187
ASQ  FLDRLPEAQQQVIKAVY----LEEIPQQDVADMLDIPLGTVKSRLRLAVEKLRL
DSQ  TTTCTCGACCGCCTGCCAGAAGCACAGCAGCAAGTGATCAAAGCGGTCTAT------------TTAGAAGAAATCCCCCAGCAAGATGTGGCCGACATGCTCGACATTCCACTCGGCACTGTGAAATCACGTCTACGTCTTGCGGTAGAAAAGTTAAGATTA
TRN  10010101100011000
NAM  Q9K7Z1_BACHD/126-175
ASQ  ALKQIPTEQREAIIRSY----FRGETHSEIATTMDKPLGSIKSLIRYGLNNLRK
DSQ  GCCCTAAAACAAATCCCAACCGAGCAAAGAGAAGCGATCATCCGCTCTTAT------------TTCCGGGGAGAAACTCATTCTGAAATTGCTACGACTATGGACAAACCATTAGGCTCCATTAAGTCACTGATTCGCTATGGCTTAAATAATTTGCGAAAG
TRN  10010101100011000
NAM  Q9KBA2_BACHD/122-171
ASQ  LLDHLNEQQKEAIQLKY----FHDLDYQTIANMTNVSVGTVKSRVFQGLKKLRE
DSQ  TTACTAGATCATTTGAATGAACAGCAAAAAGAGGCGATTCAATTAAAATAT------------TTTCACGATCTCGACTATCAAACGATTGCTAACATGACAAATGTCTCCGTTGGAACGGTCAAATCAAGAGTTTTTCAAGGATTAAAAAAACTACGAGAG
TRN  10010101110011000
NAM  Q9A7S1_CAUCR/130-179
ASQ  ALKSLSRGERLCVSLCY----GADWSHGEAAEALNIPIGTVKSHVKRGLDKLRA
DSQ  GCGCTCAAGAGCCTCTCACGGGGCGAGCGCCTGTGCGTTTCGCTTTGTTAC------------GGGGCCGACTGGTCCCACGGCGAAGCGGCGGAGGCATTGAACATCCCGATCGGCACGGTGAAATCCCATGTCAAACGTGGTTTGGACAAACTTCGGGCG
TRN  11011101101011001
NAM  Q9KF66_BACHD/114-163
ASQ  VLSELKPEETTLLVLRY----YHDFTILEIARFMNKPEGTIKAQLHRTLAKVRK
DSQ  GTTCTTTCGGAATTAAAGCCAGAGGAAACAACATTATTAGTTCTTCGCTAT------------TATCATGACTTTACGATCCTAGAGATTGCTCGGTTTATGAACAAGCCGGAAGGAACAATCAAAGCTCAATTACACCGGACATTGGCTAAAGTGCGCAAA
TRN  11011101111011010
NAM  Q9KCF6_BACHD/118-167
ASQ  MIQQLDDKYKIPIVLHY----FHDQTYQEIAQVLGITEGAVKTRMLRAKQQLKA
DSQ  ATGATTCAACAGCTTGACGATAAATACAAAATCCCGATCGTTCTCCATTAT------------TTTCACGATCAGACGTACCAGGAGATTGCTCAAGTGTTAGGGATTACAGAAGGTGCTGTTAAGACACGCATGCTTCGTGCAAAACAGCAACTTAAAGCG
TRN  11011101111011010
NAM  SIGY_BACSU/124-173
ASQ  LFSKLDPKLRTPVLLRH----YYGYTYAEIGVMLQIKEGTVKSRVHKGLQQIRK
DSQ  CTGTTTTCAAAGCTGGACCCTAAACTGCGCACACCGGTTTTATTAAGGCAT------------TACTACGGCTATACCTACGCTGAAATCGGGGTGATGCTTCAAATCAAAGAAGGCACTGTAAAGTCCAGAGTTCATAAAGGGCTCCAGCAAATCAGAAAG
TRN  10010101100011000
NAM  Q9HYV8_PSEAE/143-192
ASQ  TLNGLSELQRSVLTLRE----RQGLELEEIRDLLDITLSNVRVLLHRARLKVFA
DSQ  ACCCTCAACGGTCTGTCCGAACTGCAGCGCAGCGTGCTGACCCTGCGCGAA------------CGCCAGGGCTTGGAGCTGGAGGAAATCCGTGATCTCCTGGATATCACGCTTTCCAATGTCCGGGTGCTGCTGCATCGCGCCCGCCTGAAGGTCTTCGCC
TRN  11011111101111111
NAM  O07627_BACSU/113-162
ASQ  ELLKLKDQHQSVLILRE----FQELSYEEIAEILGWSLSKVNTTLHRARLELKK
DSQ  GAGCTCCTGAAGTTAAAAGATCAGCATCAATCCGTTTTGATTTTAAGAGAA------------TTCCAAGAGCTTTCTTATGAAGAAATCGCTGAGATATTAGGATGGAGTCTTTCTAAGGTGAATACCACATTGCACCGGGCTAGATTAGAGCTAAAGAAA
TRN  10010101100011010
NAM  Q9X8Z1_STRCO/115-163
ASQ  ALRQIPEAQRRAVVLHH----LCDLTVEQVAAEVGSPVGTVKAQLSRGRAALA-
DSQ  GCGCTGCGGCAAATACCCGAGGCGCAGCGACGGGCCGTGGTGCTCCACCAC------------CTGTGCGACCTGACGGTCGAGCAGGTGGCCGCCGAGGTCGGCAGTCCGGTCGGTACGGTCAAGGCGCAGCTGAGCCGGGGCCGGGCGGCGCTTGCC---
TRN  10010111100111011
NAM  P74595_SYNY3/202-251
ASQ  ALAGLEERTRRIVEFVF----LHDFTHKEAAEMMGVSVITVSRRIKQGIGALKK
DSQ  GCCTTAGCCGGTTTGGAAGAACGTACCCGCCGCATTGTGGAATTTGTTTTT------------CTCCACGACTTTACCCACAAGGAAGCCGCCGAAATGATGGGGGTTAGTGTGATTACCGTTTCCCGTCGCATTAAACAGGGCATTGGGGCTCTGAAAAAA
TRN  11011101101011010
NAM  Q9A3F1_CAUCR/123-172
ASQ  ALASLPQRQRMLVSDVK----LTGLSLAEAGARAGISEGAAKVALHRALKALAE
DSQ  GCCCTGGCCAGCCTGCCTCAGCGACAGAGAATGCTGGTCAGCGACGTGAAG------------CTGACGGGGTTGTCACTGGCCGAGGCAGGCGCTCGGGCGGGCATTTCCGAGGGCGCGGCCAAGGTCGCTCTCCATCGGGCGTTGAAGGCCCTGGCCGAA
TRN  10010101100011001
NAM  Q98L14_RHILO/130-179
ASQ  AVRQLPDKQRDAVLLVY----GEGLSHAAAAEAMAISETTVSWHIHEAKKRLKT
DSQ  GCGGTGCGGCAGCTTCCGGACAAGCAGCGCGACGCCGTCCTGCTGGTCTAT------------GGCGAGGGCTTGAGCCATGCGGCCGCCGCCGAGGCGATGGCGATCTCGGAGACGACGGTTTCCTGGCACATCCATGAAGCGAAGAAACGGCTGAAGACG
TRN  11011101101011011
NAM  Q98BR7_RHILO/124-173
ASQ  ALQAIAPRQREAIILVY----YQEMSNIEAAATLEISVDALESLLSRGRRALQM
DSQ  GCCTTGCAGGCGATCGCGCCACGCCAGCGCGAGGCGATCATCCTGGTCTAC------------TACCAGGAGATGTCCAACATAGAGGCGGCCGCGACCCTGGAGATCAGCGTCGATGCGCTGGAGAGCCTGCTTTCGCGCGGCCGGCGGGCCTTGCAGATG
TRN  10010111100111011
NAM  Q9L430_BORBR/119-168
ASQ  AIDALPPRCREVFVLYR----FEGLAQAEIAARLGISRNMVEKHVIRAMGACRA
DSQ  GCCATCGACGCACTGCCGCCGCGCTGCCGCGAAGTGTTCGTGCTGTACCGC------------TTCGAGGGCCTGGCGCAGGCGGAAATCGCCGCGCGCCTGGGGATCAGCCGCAACATGGTCGAGAAACACGTGATCCGCGCCATGGGCGCCTGCCGCGCC
TRN  11011101101011011
NAM  Q9I444_PSEAE/118-167
ASQ  ALAELPPRRREAFVLHK----FDGLSQVEVAERMGISLSMVEKHIASALLHCKR
DSQ  GCGCTGGCCGAGCTGCCGCCGCGGCGGCGCGAAGCGTTCGTCCTGCACAAG------------TTCGACGGCCTGTCCCAGGTCGAAGTGGCCGAGCGCATGGGAATCTCCCTGAGCATGGTGGAAAAGCACATCGCCAGCGCCTTGCTGCACTGCAAGCGG
TRN  11011111101111111
NAM  Q9I3Y1_PSEAE/188-237
ASQ  AIATLPPRCQAVFVMHK----IHEVPQAQVADRLGISVKTVEKHLRLGLAACRE
DSQ  GCCATCGCCACGCTTCCTCCTCGCTGCCAGGCCGTTTTCGTCATGCACAAG------------ATCCACGAAGTTCCCCAGGCGCAAGTCGCCGACCGCCTCGGCATCTCCGTCAAGACCGTGGAAAAGCACCTGCGCCTCGGACTGGCGGCCTGCCGGGAA
TRN  11011111101111111
NAM  Q9A9J9_CAUCR/124-173
ASQ  AIAELPTQCRRVFTLRK----VYSLSPDEIAVRLGLSVSTVEKHLVKGLRYCSE
DSQ  GCGATCGCGGAGCTGCCGACGCAGTGTCGTCGCGTCTTCACGCTGAGAAAA------------GTTTACAGCCTGTCGCCGGACGAGATAGCGGTTCGGCTGGGTCTGTCCGTCTCTACTGTCGAGAAGCATTTGGTGAAGGGTCTCCGATACTGTTCCGAA
TRN  10010101100011011
NAM  Q9I6Y3_PSEAE/117-166
ASQ  ALRGLPERTRRIFLLNR----IHGRTYAEIAQAMQLSQSAVEKHMMRALDACKA
DSQ  GCCTTGCGCGGCCTGCCCGAGCGGACCCGGCGGATTTTCCTGCTCAATCGC------------ATCCACGGCCGCACCTACGCGGAGATCGCCCAGGCCATGCAGCTTTCCCAAAGCGCCGTGGAAAAACATATGATGCGCGCCCTCGACGCCTGCAAGGCG
TRN  11011101101011011
NAM  Q9I646_PSEAE/116-165
ASQ  LLGTLSLKARSAFLYSR----LDGMPHAEIAERLGVSVPRVRQYLAQGLRQCYI
DSQ  CTGCTTGGCACGCTGTCGCTGAAGGCGCGTAGCGCGTTTCTCTATAGCCGC------------CTGGACGGCATGCCCCACGCGGAGATCGCCGAGCGTCTCGGAGTCTCGGTGCCGCGCGTGCGCCAATACCTGGCCCAGGGTCTGCGCCAGTGCTACATC
TRN  11011111101111111
NAM  Q9I222_PSEAE/116-165
ASQ  LLDGLSGQARAVFLMSQ----LEGLTYVQIGERLGLSLGRIHQLMKDALHCCYR
DSQ  CTGCTCGACGGCCTGTCCGGGCAGGCCAGGGCAGTGTTCCTGATGAGCCAG------------CTGGAAGGCCTGACCTACGTGCAGATCGGCGAACGCCTCGGATTGTCCCTGGGGCGCATCCACCAGTTGATGAAGGATGCCTTGCACTGCTGCTACCGG
TRN  10010101100011011
NAM  Q9I2W5_PSEAE/108-157
ASQ  WLVHVNPIDREILVLRF----VAELEFQEIADIMHMGLSATKMRYKRALDRLRE
DSQ  TGGCTCGTCCATGTCAATCCGATAGATCGGGAGATTCTGGTTCTTCGCTTC------------GTCGCGGAACTGGAGTTTCAGGAGATAGCGGATATCATGCACATGGGTCTGAGTGCGACGAAAATGCGCTACAAGCGGGCACTGGACCGCCTGCGCGAA
TRN  10010101100011011
NAM  Q9AD34_STRCO/172-221
ASQ  ALARLTPDQWECLRLRY----WDNLPFCEVGQRMDRSTGAAKILKDRALRSLSA
DSQ  GCTCTGGCCAGGCTGACCCCCGACCAGTGGGAGTGCTTGCGGCTGCGCTAC------------TGGGACAACCTGCCGTTCTGCGAGGTCGGCCAGCGCATGGACCGCAGCACCGGAGCGGCCAAGATACTCAAGGACCGTGCGCTGCGGAGCCTCAGCGCC
TRN  10010101100011011
//