EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04438 - zf-HIT)
FAM  PF04438
PID  zf-HIT
DES  HIT zinc finger
IPR  IPR007529
ANO  18
ALN  33
AID  0.390148
APH  (((((((Q23644_CAEEL/80-110:0.38531,YHK0_YEAST/1-31:0.28417):0.34210,((((((O22909_ARATH/445-476:0.08295,Q9M7X3_ARATH/388-419:0.25402):0.29372,(Q9I7G8_DROME/269-300:0.37696,Q99PT3_MOUSE/294-325:0.55219):0.18593):0.33968,Q9V7D9_DROME/1-30:0.19893):0.34269,YEKJ_SCHPO/1-30:0.22820):0.19358,(Q9SVU9_ARATH/5-35:0.34698,(TRIP3_HUMAN/7-36:0.08012,Q9CQK1_MOUSE/7-36:0.16258):0.44825):0.14184):0.20463,HIT1_YEAST/4-34:0.37551):0.06334):0.47310,Q9FWC3_ORYSA/32-62:0.00000):0.48658,Q9H0W3_HUMAN/104-133:1.00161):0.46065,YB85_SCHPO/98-127:0.60149):0.20070,ZNHI1_HUMAN/113-142:0.56952):0.06717,Q9FHW2_ARATH/130-159:0.35086,Q9FRE5_ORYSA/185-214:0.16075);
ATP  (((((((Q23644_CAEEL/80-110,YHK0_YEAST/1-31),((((((O22909_ARATH/445-476,Q9M7X3_ARATH/388-419),(Q9I7G8_DROME/269-300,Q99PT3_MOUSE/294-325)),Q9V7D9_DROME/1-30),YEKJ_SCHPO/1-30),(Q9SVU9_ARATH/5-35,(TRIP3_HUMAN/7-36,Q9CQK1_MOUSE/7-36))),HIT1_YEAST/4-34)),Q9FWC3_ORYSA/32-62),Q9H0W3_HUMAN/104-133),YB85_SCHPO/98-127),ZNHI1_HUMAN/113-142),Q9FHW2_ARATH/130-159,Q9FRE5_ORYSA/185-214);
ATL  10.2561
DNO  18
DLN  99
DID  0.437728
DPH  ((((((((ZNHI1_HUMAN/113-142:0.30484,(Q9FHW2_ARATH/130-159:0.42173,Q9FRE5_ORYSA/185-214:0.17310):0.07965):0.35008,YB85_SCHPO/98-127:0.23274):0.17538,Q9H0W3_HUMAN/104-133:0.54175):0.36246,HIT1_YEAST/4-34:0.23032):0.17739,(Q23644_CAEEL/80-110:0.38421,YHK0_YEAST/1-31:0.16021):0.13192):0.05524,((((Q9FWC3_ORYSA/32-62:0.44741,(TRIP3_HUMAN/7-36:0.09736,Q9CQK1_MOUSE/7-36:0.15884):0.24664):0.21749,Q9SVU9_ARATH/5-35:0.17602):0.14617,YEKJ_SCHPO/1-30:0.48820):0.08899,Q9V7D9_DROME/1-30:0.27819):0.12262):0.31198,(Q99PT3_MOUSE/294-325:0.89476,Q9I7G8_DROME/269-300:0.22641):0.29218):0.18020,O22909_ARATH/445-476:0.35948,Q9M7X3_ARATH/388-419:0.04541);
DTP  ((((((((ZNHI1_HUMAN/113-142,(Q9FHW2_ARATH/130-159,Q9FRE5_ORYSA/185-214)),YB85_SCHPO/98-127),Q9H0W3_HUMAN/104-133),HIT1_YEAST/4-34),(Q23644_CAEEL/80-110,YHK0_YEAST/1-31)),((((Q9FWC3_ORYSA/32-62,(TRIP3_HUMAN/7-36,Q9CQK1_MOUSE/7-36)),Q9SVU9_ARATH/5-35),YEKJ_SCHPO/1-30),Q9V7D9_DROME/1-30)),(Q99PT3_MOUSE/294-325,Q9I7G8_DROME/269-300)),O22909_ARATH/445-476,Q9M7X3_ARATH/388-419);
DTL  8.63959
RID  0.390148
RPH  (((((((Q23644_CAEEL/80-110:0.38531,YHK0_YEAST/1-31:0.28417):0.34210,((((((O22909_ARATH/445-476:0.08295,Q9M7X3_ARATH/388-419:0.25402):0.29372,(Q9I7G8_DROME/269-300:0.37696,Q99PT3_MOUSE/294-325:0.55219):0.18593):0.33968,Q9V7D9_DROME/1-30:0.19893):0.34269,YEKJ_SCHPO/1-30:0.22820):0.19358,(Q9SVU9_ARATH/5-35:0.34698,(TRIP3_HUMAN/7-36:0.08012,Q9CQK1_MOUSE/7-36:0.16258):0.44825):0.14184):0.20463,HIT1_YEAST/4-34:0.37551):0.06334):0.47310,Q9FWC3_ORYSA/32-62:0.00000):0.48658,Q9H0W3_HUMAN/104-133:1.00161):0.46065,YB85_SCHPO/98-127:0.60149):0.20070,ZNHI1_HUMAN/113-142:0.56952):0.06717,Q9FHW2_ARATH/130-159:0.35086,Q9FRE5_ORYSA/185-214:0.16075);
RTP  (((((((Q23644_CAEEL/80-110,YHK0_YEAST/1-31),((((((O22909_ARATH/445-476,Q9M7X3_ARATH/388-419),(Q9I7G8_DROME/269-300,Q99PT3_MOUSE/294-325)),Q9V7D9_DROME/1-30),YEKJ_SCHPO/1-30),(Q9SVU9_ARATH/5-35,(TRIP3_HUMAN/7-36,Q9CQK1_MOUSE/7-36))),HIT1_YEAST/4-34)),Q9FWC3_ORYSA/32-62),Q9H0W3_HUMAN/104-133),YB85_SCHPO/98-127),ZNHI1_HUMAN/113-142),Q9FHW2_ARATH/130-159,Q9FRE5_ORYSA/185-214);
RTL  10.2561
LNK  HIT1_YEAST/4-34:P46973:D11103
LNK  O22909_ARATH/445-476:O22909:AC002337
LNK  Q23644_CAEEL/80-110:Q23644:Z70783
LNK  Q99PT3_MOUSE/294-325:Q99PT3:AB054537
LNK  Q9CQK1_MOUSE/7-36:Q9CQK1:AK014350
LNK  Q9FHW2_ARATH/130-159:Q9FHW2:AB017068
LNK  Q9FRE5_ORYSA/185-214:Q9FRE5:AC082644
LNK  Q9FWC3_ORYSA/32-62:Q9FWC3:AC051634
LNK  Q9H0W3_HUMAN/104-133:Q9H0W3:AL136611
LNK  Q9I7G8_DROME/269-300:Q9I7G8:AE003787
LNK  Q9M7X3_ARATH/388-419:Q9M7X3:AC023912
LNK  Q9SVU9_ARATH/5-35:Q9SVU9:AL035353
LNK  Q9V7D9_DROME/1-30:Q9V7D9:AE003810
LNK  TRIP3_HUMAN/7-36:Q15649:AF400652
LNK  YB85_SCHPO/98-127:O59669:AL022299
LNK  YEKJ_SCHPO/1-30:O36031:Z98980
LNK  YHK0_YEAST/1-31:P38772:U00062
LNK  ZNHI1_HUMAN/113-142:O43257:AF093571
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FRE5_ORYSA/185-214
ASQ  RRHYCS--VC-GSTANYTCVRCGTRFCSCRCQV
DSQ  CGGCGCCATTACTGCTCG------GTCTGC---GGCAGCACGGCGAACTACACGTGCGTCAGGTGCGGGACGAGGTTCTGCTCGTGCCGCTGCCAGGTC
TRN  10110101110011011
NAM  Q9FHW2_ARATH/130-159
ASQ  RRYFCS--VC-GYIAGYNCCLCGMRFCSIRCQN
DSQ  CGTCGCTATTTTTGCTCG------GTTTGT---GGTTACATTGCAGGTTACAATTGTTGTTTATGTGGGATGAGGTTTTGTTCTATTCGTTGTCAAAAT
TRN  10110101110011010
NAM  ZNHI1_HUMAN/113-142
ASQ  QRPFCA--VC-GFPSPYTCVSCGARYCTVRCLG
DSQ  CAGCGCCCCTTCTGTGCT------GTCTGT---GGCTTCCCATCCCCCTACACCTGTGTCAGCTGCGGTGCCCGGTACTGCACTGTGCGCTGTCTGGGG
TRN  11011111101111111
NAM  YB85_SCHPO/98-127
ASQ  PRKFCN--VC-GYWGKYACQNCGTSYCSKGCEV
DSQ  CCGCGAAAATTCTGTAAT------GTATGT---GGTTATTGGGGAAAATATGCTTGTCAAAATTGTGGAACTAGTTATTGCTCAAAAGGGTGTGAGGTT
TRN  11111101111011001
NAM  Q9CQK1_MOUSE/7-36
ASQ  RTAVCV--VC-LEKPKYRCPTCRVPYCSVPCFQ
DSQ  AGGACTGCGGTCTGTGTG------GTCTGT---TTGGAGAAGCCGAAATACCGTTGCCCGACTTGCCGCGTGCCCTACTGTTCGGTCCCCTGTTTTCAG
TRN  10110101110011011
NAM  TRIP3_HUMAN/7-36
ASQ  STVVCV--IC-LEKPKYRCPACRVPYCSVVCFR
DSQ  AGCACCGTCGTCTGCGTG------ATCTGC---TTGGAGAAGCCCAAATACCGCTGTCCAGCCTGCCGCGTGCCCTACTGCTCGGTAGTCTGCTTCCGG
TRN  11111101111011011
NAM  Q9V7D9_DROME/1-30
ASQ  -MEKCI--ICVDNLRKYKCSKCSAPYCSVACYK
DSQ  ---ATGGAAAAATGCATT------ATTTGCGTAGATAACTTGAGAAAATACAAGTGCAGCAAATGCTCGGCACCCTACTGCTCTGTGGCTTGTTATAAG
TRN  10110101110011011
NAM  HIT1_YEAST/4-34
ASQ  SAVKCG--ICRGVDGKYKCPKCGVRYCSLKCYK
DSQ  AGTGCAGTTAAATGTGGC------ATATGTCGCGGAGTTGATGGTAAATATAAATGTCCTAAATGTGGCGTACGATATTGCTCCTTGAAATGCTATAAA
TRN  10010101110011011
NAM  Q9SVU9_ARATH/5-35
ASQ  ATQTCE--ICEKVVSKYKCPSCLVPYCSLGCFK
DSQ  GCTACTCAAACATGCGAA------ATCTGCGAGAAGGTTGTATCCAAATACAAGTGTCCTTCTTGTCTTGTTCCTTACTGCTCATTGGGTTGTTTCAAG
TRN  11011101111011001
NAM  YEKJ_SCHPO/1-30
ASQ  -MTTCS--ICNESEIKYKCPKCSFPYCSLPCWK
DSQ  ---ATGACAACTTGTTCA------ATATGCAACGAATCAGAAATAAAATATAAATGCCCGAAGTGTTCATTTCCTTATTGTTCATTACCTTGCTGGAAA
TRN  10010101110011000
NAM  YHK0_YEAST/1-31
ASQ  MAVLCG--VCGIKEFKYKCPRCLVQTCSLECSK
DSQ  ATGGCGGTGTTGTGTGGT------GTATGCGGAATAAAAGAGTTCAAATACAAGTGTCCAAGATGTTTGGTGCAAACTTGCTCTTTGGAGTGTTCCAAG
TRN  10010101110011011
NAM  Q23644_CAEEL/80-110
ASQ  DPKLCK--VCLKNEHKYKCPRCEMRTCSLDCSK
DSQ  GATCCAAAATTATGTAAA------GTTTGTTTGAAAAACGAGCACAAGTACAAATGCCCAAGATGTGAAATGCGGACATGTTCACTGGATTGTTCAAAG
TRN  10010101100011000
NAM  Q9FWC3_ORYSA/32-62
ASQ  TRVICR--VCQKQFAQYTCPRCNARYCSLPCYK
DSQ  ACCAGGGTCATCTGCCGC------GTGTGCCAGAAGCAGTTCGCGCAGTACACTTGCCCCCGTTGTAACGCCCGGTACTGCTCGCTCCCGTGCTACAAG
TRN  10010101110011011
NAM  Q99PT3_MOUSE/294-325
ASQ  PAPRCSVPGC-PHPRRYACSRTGQALCSLQCYR
DSQ  CCCGCTCCACGATGCTCTGTCCCCGGCTGC---CCCCACCCGCGTCGTTATGCCTGCTCCCGCACCGGCCAGGCCCTTTGCAGCCTACAGTGCTACCGC
TRN  11011111111111111
NAM  Q9I7G8_DROME/269-300
ASQ  PSQVCFVSGC-ENRKTYNCSTTNVPLCSLTCYR
DSQ  CCTTCACAGGTGTGCTTTGTAAGCGGTTGT---GAAAATCGCAAGACATATAATTGTTCAACAACAAATGTTCCATTATGTAGTCTTACATGTTATCGT
TRN  11011111111111100
NAM  Q9M7X3_ARATH/388-419
ASQ  PREKCVGPNC-EKAYKYRDSKSKLPLCSLGCYN
DSQ  CCGCGAGAGAAATGTGTGGGACCAAATTGC---GAGAAAGCGTACAAGTACAGGGATTCAAAGTCGAAGCTGCCATTATGTAGTCTCGGATGTTACAAC
TRN  10010101100011000
NAM  O22909_ARATH/445-476
ASQ  PRENCVGPSC-TNPYKYRDSKTKVPLCSLKCYK
DSQ  CCGCGGGAAAATTGTGTGGGTCCATCGTGC---ACCAATCCTTACAAGTATCGTGACTCGAAGACTAAAGTTCCTCTATGCAGTCTCAAATGCTACAAA
TRN  11011101111011011
NAM  Q9H0W3_HUMAN/104-133
ASQ  GEPICV--VC-GRYGEYICDKTDEDVCSLECKA
DSQ  GGGGAACCCATCTGTGTT------GTCTGT---GGTCGTTATGGAGAGTATATCTGTGATAAGACAGATGAAGATGTGTGTAGTTTGGAGTGTAAAGCG
TRN  11111101111011011
//