EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04420 - CHD5)
FAM  PF04420
PID  CHD5
DES  CHD5-like protein
IPR  IPR007514
ANO  4
ALN  193
AID  0.295075
APH  (WRB_HUMAN/12-164:0.03528,(Q9HGM2_SCHPO/6-165:1.45455,YGC0_YEAST/2-193:1.28401):0.80628,Q9D1W0_MOUSE/12-164:0.10550);
ATP  (WRB_HUMAN/12-164,(Q9HGM2_SCHPO/6-165,YGC0_YEAST/2-193),Q9D1W0_MOUSE/12-164);
ATL  3.68562
DNO  4
DLN  579
DID  0.444871
DPH  (WRB_HUMAN/12-164:0.07311,(Q9HGM2_SCHPO/6-165:0.91918,YGC0_YEAST/2-193:0.72760):0.47870,Q9D1W0_MOUSE/12-164:0.14106);
DTP  (WRB_HUMAN/12-164,(Q9HGM2_SCHPO/6-165,YGC0_YEAST/2-193),Q9D1W0_MOUSE/12-164);
DTL  2.33965
RID  0.295075
RPH  (WRB_HUMAN/12-164:0.03528,(Q9HGM2_SCHPO/6-165:1.45455,YGC0_YEAST/2-193:1.28401):0.80628,Q9D1W0_MOUSE/12-164:0.10550);
RTP  (WRB_HUMAN/12-164,(Q9HGM2_SCHPO/6-165,YGC0_YEAST/2-193),Q9D1W0_MOUSE/12-164);
RTL  3.68562
LNK  Q9D1W0_MOUSE/12-164:Q9D1W0:AK021091
LNK  Q9HGM2_SCHPO/6-165:Q9HGM2:AL391604
LNK  WRB_HUMAN/12-164:O00258:AL163279
LNK  YGC0_YEAST/2-193:P53192:Z72542
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9D1W0_MOUSE/12-164
ASQ  LLVLSFVFGCNLLRILLPSL-SSFISRVLQ---KDAEQESQMR--AEIQGMKQELSTVNMMDEFARYARL-------ERKINKMTDKLKTHVKARTAQLAKIKWF-ISVAFYILQAALMISLIWKYYSV-----------------------PVAVVPSKW-ITPLDR--LVAFPTRVAGNCFLEIRWWWEIR
DSQ  CTGCTGGTGTTGAGCTTCGTGTTCGGGTGTAACTTGCTGCGCATCCTCCTGCCGTCCCTG---TCCTCGTTTATTTCCAGGGTGCTGCAG---------AAGGATGCAGAGCAGGAGTCACAGATGAGG------GCAGAGATCCAGGGCATGAAGCAGGAGCTGTCCACCGTCAACATGATGGACGAGTTTGCCAGATACGCCAGGCTG---------------------GAAAGGAAGATCAACAAGATGACGGACAAGCTCAAAACGCACGTGAAGGCACGGACAGCTCAGTTGGCCAAGATCAAGTGGTTT---ATAAGTGTTGCTTTCTACATACTACAAGCAGCGCTGATGATCTCGCTCATTTGGAAGTATTACTCCGTC---------------------------------------------------------------------CCTGTGGCTGTGGTGCCCAGCAAGTGG---ATCACCCCACTAGACCGC------CTGGTAGCCTTTCCTACTCGAGTAGCAGGTAATTGTTTTCTGGAAATACGGTGGTGGTGGGAGATTAGA
TRN  10010101100011001
NAM  WRB_HUMAN/12-164
ASQ  LLVLSFVFGCNVLRILLPSF-SSFMSRVLQ---KDAEQESQMR--AEIQDMKQELSTVNMMDEFARYARL-------ERKINKMTDKLKTHVKARTAQLAKIKWV-ISVAFYVLQAALMISLIWKYYSV-----------------------PVAVVPSKW-ITPLDR--LVAFPTRVAGGVGITCWILVCNK
DSQ  TTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTC---TCATCCTTCATGTCCAGGGTGCTGCAG---------AAGGACGCGGAGCAGGAGTCACAGATGAGA------GCGGAGATCCAGGACATGAAGCAGGAGCTCTCCACAGTCAACATGATGGACGAGTTTGCCAGATATGCCAGGCTG---------------------GAAAGAAAGATCAACAAGATGACGGATAAGCTCAAAACCCATGTGAAAGCTCGGACAGCTCAATTAGCCAAGATAAAATGGGTG---ATAAGTGTCGCTTTCTACGTATTGCAGGCTGCCCTGATGATCTCACTCATTTGGAAGTATTATTCTGTC---------------------------------------------------------------------CCTGTGGCTGTCGTGCCGAGTAAATGG---ATAACCCCTCTAGACCGC------CTGGTAGCCTTTCCTACTAGAGTAGCAGGTGGTGTTGGAATTACCTGTTGGATTTTAGTCTGTAACAAA
TRN  10010101100011000
NAM  Q9HGM2_SCHPO/6-165
ASQ  ISTILLSLFIHFFDKFAKKRTIDGAYRIYVSVSNNKDLKKNKEILEQLLTVKKELNATSSQDQFAKWARL-------NRKYEQLSQEWEKQSANVKIFQDTFKRV-LSLFLWILTRGFRFYIQFKESKT-----------------------PVFFLPAFL--LPSWALWVLSLPRSIYGSVSLTVWNFAVQK
DSQ  ATTTCAACAATTTTATTAAGCTTATTTATTCATTTCTTCGATAAATTTGCAAAAAAAAGGACTATTGATGGGGCTTATCGAATTTACGTTAGTGTTTCTAATAATAAAGATTTAAAGAAGAACAAAGAAATTTTAGAGCAGCTGCTTACTGTTAAGAAAGAGCTAAACGCTACTAGCAGTCAAGATCAGTTTGCTAAATGGGCCCGTCTG---------------------AATAGAAAGTATGAACAACTCAGTCAAGAGTGGGAAAAACAATCAGCCAATGTTAAAATTTTCCAAGATACTTTCAAGCGGGTT---TTAAGCCTTTTTCTTTGGATTTTAACCCGTGGATTCCGGTTTTATATTCAATTCAAAGAGTCCAAAACA---------------------------------------------------------------------CCTGTCTTTTTCCTCCCTGCATTCTTG------CTTCCTTCTTGGGCTCTATGGGTGCTATCTCTTCCACGATCAATCTACGGATCGGTTAGCTTAACAGTTTGGAATTTTGCGGTTCAAAAA
TRN  10010101100011000
NAM  YGC0_YEAST/2-193
ASQ  HWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIME-GKFGASKFDDMALQSVSLGIWVWALMN
DSQ  CATTGGGCAGCAGCGGTAGCGATATTCTTTATTGTGGTCACAAAGTTTCTACAGTATACAAACAAATACCACGAGAAATGGATCTCTAAATTTGCACCAGGAAATGAATTATCCAAAAAATACTTAGCCAAGGTCAAAGAACGTCACGAATTAAAAGAATTCAACAACTCTATCTCCGCGCAGGATAATTATGCCAAATGGACTAAGAACAATAGAAAATTGGACTCGTTAGATAAAGAAATAAATAACTTGAAGGACGAAATACAATCAGAAAATAAAGCCTTTCAGGCCCATCTTCACAAACTCAGGTTATTGGCATTGACGGTGCCATTTTTTGTGTTTAAGATTATGTACGGCAAGACACCAGTTTACAAGTTGAGTTCCTCGACTAGCACCTTGTTCCCTACGTTTGTAAGTGGTGTTTGGTCTCAAGGCTGGTTATATGTTCTCTTGCATCCTCTAAGGACTATTTCTCAGAAATGGCATATAATGGAG---GGCAAATTTGGTGCTTCCAAGTTTGATGATATGGCTTTACAGAGTGTCTCTTTGGGAATCTGGGTTTGGGCATTGATGAAT
TRN  10010101110011000
//