EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04376 - ATE_N)
FAM  PF04376
PID  ATE_N
DES  Arginine-tRNA-protein transferase, N terminus
IPR  IPR007471
ANO  11
ALN  116
AID  0.309537
APH  ((((((ATE_RHILO/7-95:0.30843,ATE_CAUCR/8-96:0.27985):0.29964,(ATE_VIBCH/6-94:0.65185,(ATE_XYLFA/9-97:0.63769,ATE_PSEAE/5-93:0.38366):0.17023):0.16706):0.37566,ATE_CAMJE/1-88:1.03262):0.71727,ATE1_YEAST/8-123:1.20955):0.23336,(ATE1_HUMAN/16-100:0.30500,ATE1_DROME/4-93:0.48707):0.13292):0.31874,ATE1_ARATH/19-109:0.14766,Q9C776_ARATH/23-113:0.14304);
ATP  ((((((ATE_RHILO/7-95,ATE_CAUCR/8-96),(ATE_VIBCH/6-94,(ATE_XYLFA/9-97,ATE_PSEAE/5-93))),ATE_CAMJE/1-88),ATE1_YEAST/8-123),(ATE1_HUMAN/16-100,ATE1_DROME/4-93)),ATE1_ARATH/19-109,Q9C776_ARATH/23-113);
ATL  8.00123
DNO  11
DLN  348
DID  0.400018
DPH  (ATE_RHILO/7-95:0.24994,(ATE_PSEAE/5-93:0.24421,(ATE_XYLFA/9-97:0.44837,(ATE_VIBCH/6-94:0.38025,((ATE1_DROME/4-93:0.36058,(ATE1_HUMAN/16-100:0.32514,(Q9C776_ARATH/23-113:0.13018,ATE1_ARATH/19-109:0.11352):0.31309):0.10402):0.28542,(ATE_CAMJE/1-88:0.60788,ATE1_YEAST/8-123:0.71696):0.10314):0.39492):0.31398):0.09652):0.24097,ATE_CAUCR/8-96:0.37389);
DTP  (ATE_RHILO/7-95,(ATE_PSEAE/5-93,(ATE_XYLFA/9-97,(ATE_VIBCH/6-94,((ATE1_DROME/4-93,(ATE1_HUMAN/16-100,(Q9C776_ARATH/23-113,ATE1_ARATH/19-109))),(ATE_CAMJE/1-88,ATE1_YEAST/8-123))))),ATE_CAUCR/8-96);
DTL  5.80298
RID  0.309537
RPH  ((((((ATE_RHILO/7-95:0.30843,ATE_CAUCR/8-96:0.27985):0.29964,(ATE_VIBCH/6-94:0.65185,(ATE_XYLFA/9-97:0.63769,ATE_PSEAE/5-93:0.38366):0.17023):0.16706):0.37566,ATE_CAMJE/1-88:1.03262):0.71727,ATE1_YEAST/8-123:1.20955):0.23336,(ATE1_HUMAN/16-100:0.30500,ATE1_DROME/4-93:0.48707):0.13292):0.31874,ATE1_ARATH/19-109:0.14766,Q9C776_ARATH/23-113:0.14304);
RTP  ((((((ATE_RHILO/7-95,ATE_CAUCR/8-96),(ATE_VIBCH/6-94,(ATE_XYLFA/9-97,ATE_PSEAE/5-93))),ATE_CAMJE/1-88),ATE1_YEAST/8-123),(ATE1_HUMAN/16-100,ATE1_DROME/4-93)),ATE1_ARATH/19-109,Q9C776_ARATH/23-113);
RTL  8.00123
LNK  ATE1_ARATH/19-109:Q9ZT48:AF079100
LNK  ATE1_DROME/4-93:O96539:AF079101
LNK  ATE1_HUMAN/16-100:O95260:BC022026
LNK  ATE1_YEAST/8-123:P16639:Z72539
LNK  ATE_CAMJE/1-88:Q9PNQ6:AL139077
LNK  ATE_CAUCR/8-96:Q9A7Z5:AE005831
LNK  ATE_PSEAE/5-93:Q9I0M0:AE004690
LNK  ATE_RHILO/7-95:Q983E4:AP003013
LNK  ATE_VIBCH/6-94:Q9KRA6:AE004251
LNK  ATE_XYLFA/9-97:Q9PEL0:AE003939
LNK  Q9C776_ARATH/23-113:Q9C776:AC073395
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ATE_CAUCR/8-96
ASQ  RQLRFFLTAPTPCPYLPGREERKV--------------------------FAHLPLSDGPIVNDSLTQVGFRRSQNIAYRPAC-ETCRACQSARAPATEYILSRSERKILGRNDDL
DSQ  CGACAGCTTCGGTTCTTTCTGACGGCGCCCACGCCTTGCCCGTACCTGCCCGGTCGCGAGGAGCGGAAGGTC------------------------------------------------------------------------------TTCGCCCACCTGCCGCTGTCCGACGGCCCCATCGTCAATGACAGCCTGACCCAGGTCGGCTTTCGCCGCTCCCAGAACATCGCTTATCGCCCCGCCTGC---GAGACATGCCGTGCATGTCAGTCCGCTCGCGCGCCGGCGACGGAGTACATCCTGTCGCGCTCCGAGCGAAAGATCCTCGGCCGCAACGATGATCTG
TRN  11011111101111111
NAM  ATE_RHILO/7-95
ASQ  QSPQFFLTAPSPCPYLDGQFERKV--------------------------FTHLVGDKASEMNDLLTQGGFRRSQNIAYRPAC-ETCRACVSVRILAQEFTASRNMKRVLQHNSDL
DSQ  CAGTCGCCGCAGTTCTTCCTGACCGCGCCGTCGCCGTGCCCCTATCTCGACGGCCAGTTCGAGCGGAAGGTG------------------------------------------------------------------------------TTCACGCATCTGGTCGGCGACAAGGCGTCGGAGATGAACGACCTGTTGACGCAAGGCGGCTTCCGGCGGTCACAGAACATTGCCTACCGGCCGGCCTGC---GAGACCTGCCGCGCCTGCGTTTCGGTGCGCATCCTCGCCCAGGAATTCACCGCCAGCCGCAACATGAAGCGTGTGCTGCAGCACAATTCCGACCTC
TRN  11011111101111101
NAM  ATE_PSEAE/5-93
ASQ  ARLKFYATQPHPCSYLPEEQ-ATTL-------------------------FLDPSQPMDTQLYASLSEVGFRRSGDHLYRPHC-QHCTACIAARIPVADFSPNRQQRRILKRNAEL
DSQ  GCCCGACTGAAGTTCTACGCGACGCAACCGCACCCGTGCAGCTACCTGCCCGAGGAGCAG---GCAACCACCCTG---------------------------------------------------------------------------TTCCTCGATCCCAGCCAGCCCATGGACACGCAGCTGTACGCCTCGCTGTCGGAGGTCGGCTTCCGCCGCAGCGGCGACCATCTCTATCGTCCGCACTGC---CAGCATTGCACCGCCTGCATCGCCGCGCGCATACCGGTCGCCGACTTCAGCCCGAACCGCCAGCAGCGGCGCATCCTCAAGCGCAATGCGGAACTG
TRN  10010111100111011
NAM  ATE_XYLFA/9-97
ASQ  DDLQLFKTNLHPCGYWPDRWASDL--------------------------VMDPNDPRLGAIYPQALAWGFRRSGNLLYRPHC-EHCNACVPVRVNVNAFVPNRSQRRCLARNATL
DSQ  GACGACCTACAGCTATTCAAGACCAACCTTCACCCATGCGGTTACTGGCCGGACAGATGGGCAAGCGATTTG------------------------------------------------------------------------------GTCATGGACCCAAACGACCCCCGCCTGGGTGCCATCTACCCACAAGCCCTGGCTTGGGGCTTCCGCCGCTCCGGCAACCTGCTGTACAGACCACACTGC---GAACACTGCAATGCCTGCGTCCCAGTACGCGTCAATGTCAATGCTTTCGTTCCAAATCGCAGCCAGCGTCGCTGCCTGGCCCGCAACGCCACGCTT
TRN  10010101100011011
NAM  ATE_VIBCH/6-94
ASQ  QQIRIGLTNNHPCSYLADRM-ERVA-------------------------VAIDPQMQTPETYEVLMANGFRRSGDTIYKPHC-DHCQSCQALRIPAPDFVPSKSQKRLLKLLSQE
DSQ  CAGCAAATTCGTATTGGCTTAACCAATAACCATCCTTGTAGCTACTTAGCGGATCGGATG---GAGCGCGTCGCC---------------------------------------------------------------------------GTGGCGATTGATCCGCAGATGCAAACCCCCGAAACCTATGAAGTGCTGATGGCAAATGGTTTTCGGCGCAGCGGCGATACCATCTACAAACCGCATTGT---GATCATTGCCAGTCTTGCCAAGCTCTGCGAATTCCTGCGCCCGATTTTGTGCCAAGTAAAAGCCAAAAACGTTTACTCAAGCTGCTCAGCCAAGAG
TRN  11011101101011010
NAM  ATE_CAMJE/1-88
ASQ  MLEIGFCTLEDQCPYLKDKRSRIEY---------------------------KYIENCPKEINNELIKRGWRRFGRYFSRPIC-KDCDECLSLRILVNEYNFSRSERRVVNKNINT
DSQ  ATGCTTGAGATTGGTTTTTGTACTCTTGAAGATCAGTGTCCTTACTTAAAGGATAAACGTTCAAGAATAGAGTAT---------------------------------------------------------------------------------AAATACATTGAAAATTGCCCTAAAGAAATCAATAATGAGCTAATAAAACGAGGTTGGCGTCGTTTTGGTAGGTATTTTTCACGCCCTATTTGT---AAAGATTGTGATGAATGTTTAAGTCTTAGAATTTTAGTTAATGAATATAATTTTTCAAGAAGTGAAAGAAGGGTTGTAAATAAAAATATTAACACC
TRN  10010101110011000
NAM  ATE1_DROME/4-93
ASQ  SIVSYYGSQQSKCGYCAGANCSLS--------------------------HGMHAYQLDCRDYQDLIDRGWRRCGYYCYKLRNQETCCPCYTIKCNGLEFKLSKSNKRILRRINRF
DSQ  AGCATTGTGAGTTACTATGGCAGCCAGCAGAGCAAGTGCGGCTACTGCGCGGGAGCGAACTGCAGCCTGTCG------------------------------------------------------------------------------CACGGTATGCACGCGTATCAGCTGGACTGCCGGGACTATCAGGACCTCATCGATCGCGGCTGGCGGCGGTGCGGCTACTACTGCTACAAGCTGCGCAACCAGGAGACCTGCTGCCCCTGCTACACAATCAAATGTAATGGCCTGGAGTTCAAGCTCTCCAAGTCGAACAAGCGCATACTTCGCCGCATAAATCGATTT
TRN  10010101100011011
NAM  ATE1_HUMAN/16-100
ASQ  PSEDFY-----RCGYCKNESGSRS--------------------------NGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKF
DSQ  CCTAGCGAGGACTTCTAC---------------CGCTGCGGCTACTGCAAGAACGAGTCGGGCAGCCGCTCC------------------------------------------------------------------------------AATGGCATGTGGGCACATTCCATGACAGTACAGGATTATCAGGATCTCATAGACCGAGGATGGCGAAGAAGTGGAAAATATGTGTACAAACCTGTCATGAATCAAACATGTTGTCCTCAGTACACAATAAGGTGCCGACCTTTACAATTTCAGCCTTCAAAATCTCACAAGAAGGTTTTGAAAAAAATGTTGAAATTT
TRN  10010101110011000
NAM  Q9C776_ARATH/23-113
ASQ  SIVADCGRNKSTCGYCKSSTRFSIS-------------------------HGLWTERLTVNDYQALLDSGWRRSGCYLYKPEMEKTCCPSYTIRLKASDFVPSKEQQRVRRRIERF
DSQ  AGTATAGTCGCTGATTGTGGACGAAATAAATCAACTTGCGGTTACTGTAAATCTTCTACCCGCTTTAGTATTTCT---------------------------------------------------------------------------CACGGTTTATGGACAGAGAGACTCACCGTTAATGACTATCAAGCTCTTCTTGACAGTGGATGGAGACGATCTGGCTGCTATCTTTACAAACCTGAGATGGAGAAGACTTGTTGCCCTTCTTATACAATCCGCTTGAAAGCAAGTGATTTTGTCCCTTCTAAGGAGCAGCAGCGAGTGCGTAGAAGAATAGAAAGGTTT
TRN  10010101110011000
NAM  ATE1_ARATH/19-109
ASQ  SVIDDHGRRKSTCGYCKSPARSSIS-------------------------HGLSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDKTCCPPYTIRLKASDFVPTKEQQRVSRRLERF
DSQ  AGCGTAATCGATGATCATGGCCGCCGTAAAAGCACTTGCGGCTACTGTAAATCCCCAGCTCGGTCCAGTATCTCT---------------------------------------------------------------------------CACGGTTTATCAGCACAGACTCTTACCGTTTATGACTACCAAGCTCTTATTGACCGAGGCTGGAGAAGATCTGGTACTTATCTTTACAAACATGAGATGGATAAAACGTGTTGCCCTCCTTATACGATACGTTTGAAAGCAAGTGATTTTGTTCCTACTAAAGAGCAGCAGCGAGTTTCTAGAAGACTAGAAAGGTTC
TRN  10010101110011000
NAM  ATE1_YEAST/8-123
ASQ  WAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGSFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRFATR
DSQ  TGGGCTCCCTCGATGCACAATGAACCTGCCGCAAAGTGTGGGTATTGTCACGGTAATAAGGGGGGCAACATGGATCAGTTGTTCGCATTGGATTCGTGGGCTCATCGTTATATGAACAAAATGGACGTTGTAAAGATTGAAAACTGCACAATTGGCTCTTTCGTGGAACATATGGATGTAGCCACGTATGATCGCATGTGTAATATGGGATTTAGAAGGTCTGGTAAGTTTCTTTATAAAGTGGACCCGTTGAGGAATTGTTGTAGGTTATACACCATTCGAACTGCCCCTCAAGAATTGAATATGACAAAGGAATTGAAAAAATGCATCAGCCGCTTTGCTACTAGA
TRN  10010101110011010
//