EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04345 - Chor_lyase)
FAM  PF04345
PID  Chor_lyase
DES  Chorismate lyase
IPR  IPR007440
ANO  3
ALN  177
AID  0.269978
APH  (Q9CMB5_PASMU/7-170:0.93617,Q9HTK1_PSEAE/1-175:0.81046,Q9KVP6_VIBCH/15-183:1.02560);
ATP  (Q9CMB5_PASMU/7-170,Q9HTK1_PSEAE/1-175,Q9KVP6_VIBCH/15-183);
ATL  2.77223
DNO  3
DLN  531
DID  0.389251
DPH  (Q9CMB5_PASMU/7-170:0.66776,Q9HTK1_PSEAE/1-175:0.76696,Q9KVP6_VIBCH/15-183:0.50582);
DTP  (Q9CMB5_PASMU/7-170,Q9HTK1_PSEAE/1-175,Q9KVP6_VIBCH/15-183);
DTL  1.94054
RID  0.269978
RPH  (Q9CMB5_PASMU/7-170:0.93617,Q9HTK1_PSEAE/1-175:0.81046,Q9KVP6_VIBCH/15-183:1.02560);
RTP  (Q9CMB5_PASMU/7-170,Q9HTK1_PSEAE/1-175,Q9KVP6_VIBCH/15-183);
RTL  2.77223
LNK  Q9CMB5_PASMU/7-170:Q9CMB5:AE006131
LNK  Q9HTK1_PSEAE/1-175:Q9HTK1:AE004947
LNK  Q9KVP6_VIBCH/15-183:Q9KVP6:AE004100
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CMB5_PASMU/7-170
ASQ  LLQNATWQPSTDMQ-LPLSISSWLELSTSLTTQLKQAFG-EVNVCVLAESWITTLNENERQFFPKQACPCWCREVILKSQDIPLIFARTLIP-ASLLTQHSELQQLGNRALGEWLFMQSDRIRQKLELTHDKNT---------ALYARRALMSIGAENMMVAELFLT-PQIFTRVVK
DSQ  TTGTTACAAAATGCCACTTGGCAGCCTTCAACGGATATGCAA---TTACCTCTGTCGATTTCTTCTTGGCTAGAGCTATCCACATCTTTAACTACACAGCTAAAACAAGCTTTTGGC---GAAGTGAATGTATGTGTCTTAGCCGAGTCATGGATAACGACGCTTAACGAGAATGAACGTCAATTTTTTCCAAAACAAGCATGTCCGTGTTGGTGTCGAGAAGTGATCTTAAAAAGCCAAGATATACCATTAATTTTTGCGCGTACTTTAATTCCG---GCTTCTTTATTGACGCAGCATAGTGAATTACAACAATTGGGCAATCGTGCGTTAGGTGAGTGGCTGTTTATGCAATCTGATCGTATAAGGCAAAAATTAGAATTAACGCATGATAAAAACACC---------------------------GCACTTTATGCCCGCCGTGCCTTAATGAGTATTGGCGCTGAGAATATGATGGTTGCTGAATTATTTCTAACA---CCACAAATTTTTACGAGAGTAGTCAAA
TRN  10010101100011000
NAM  Q9HTK1_PSEAE/1-175
ASQ  MPSNALWLRADQLSSVSPAVLDWLFDEGSLTRRLTALADGAFRVEPLLEGWQTLRDDECQGLDVPTGSSGWVREVYLHGHDRPWVFARSVAARSALEGSGFDLALLGTRSLGELLFSDSAFERGPIEVCRYPAAGLPAEVRAEGLWGRRSRFSRGALGVLVAEVYL--PRLWDQAGI
DSQ  ATGCCCAGCAATGCGCTCTGGCTTCGCGCCGACCAACTGTCCAGCGTCTCCCCCGCCGTCCTCGACTGGCTGTTCGACGAGGGGTCGCTGACCCGGCGCCTGACCGCCCTGGCCGACGGCGCGTTCCGCGTCGAACCCCTGCTGGAAGGCTGGCAGACCCTGCGCGACGACGAATGCCAGGGGCTCGACGTCCCTACCGGCAGTAGCGGCTGGGTCCGCGAGGTCTACCTGCATGGCCACGACCGTCCCTGGGTGTTCGCCCGCAGCGTGGCGGCGCGCAGCGCCCTGGAAGGCTCGGGCTTCGACCTGGCGCTGCTCGGCACCCGCTCGCTGGGCGAGTTGCTGTTCAGCGACAGCGCCTTCGAGCGCGGGCCCATCGAAGTCTGCCGCTATCCGGCGGCCGGTCTGCCCGCCGAGGTCCGCGCCGAGGGTCTCTGGGGCCGTCGCTCACGGTTTTCCCGCGGCGCGCTCGGGGTGCTGGTGGCGGAGGTGTACCTA------CCGCGCCTGTGGGACCAGGCGGGAATC
TRN  11011111101111101
NAM  Q9KVP6_VIBCH/15-183
ASQ  ALNRVTWQQPDDIEFPAPLAQQWLLEQGSLSRRMATQCE-HLTVDLLSNQIMLADTLSYDETQLLASEEYLLRQVIIYGDQQPWVFGHTLIPRSSMHNQPFDFTQQGKIPLGLTVFSADNVKRDALQVGWVETELG-------RLLARRSRLWMNNKPMLVTELFLATSPIYSKERV
DSQ  GCACTGAATCGCGTCACTTGGCAACAGCCTGATGACATTGAATTTCCAGCCCCTTTAGCTCAGCAATGGCTACTCGAACAAGGCTCTCTTTCGCGCCGAATGGCGACGCAGTGTGAG---CATCTGACCGTAGATTTATTAAGTAACCAAATCATGCTGGCGGACACCCTGAGCTATGATGAAACTCAACTGCTCGCCTCTGAAGAGTATCTTCTACGCCAAGTGATTATTTATGGCGACCAACAACCTTGGGTATTTGGCCATACTTTGATCCCTCGCTCATCCATGCACAATCAGCCGTTTGATTTCACCCAACAAGGGAAAATTCCACTAGGTCTCACCGTATTTAGTGCGGATAATGTTAAGCGAGATGCACTGCAAGTTGGCTGGGTAGAGACAGAACTCGGA---------------------CGACTATTAGCCCGTCGCTCTCGCTTATGGATGAACAACAAACCCATGTTAGTGACGGAGCTGTTTCTCGCCACATCCCCGATTTACTCTAAGGAGAGAGTG
TRN  10010101100011000
//