EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04340 - DUF484)
FAM  PF04340
PID  DUF484
DES  Protein of unknown function, DUF484
IPR  IPR007435
ANO  6
ALN  233
AID  0.246444
APH  ((((YIGA_ECOLI/10-233:0.71312,Q9CKC1_PASMU/1-227:0.73476):0.43681,Q9KVL5_VIBCH/4-221:0.49497):0.50732,Q51565_PSEAE/7-227:0.45487):0.21730,Q9AB86_CAUCR/7-225:1.43314,Q9PD97_XYLFA/6-226:0.87884);
ATP  ((((YIGA_ECOLI/10-233,Q9CKC1_PASMU/1-227),Q9KVL5_VIBCH/4-221),Q51565_PSEAE/7-227),Q9AB86_CAUCR/7-225,Q9PD97_XYLFA/6-226);
ATL  5.87114
DNO  6
DLN  699
DID  0.393141
DPH  (Q9KVL5_VIBCH/4-221:0.42947,(YIGA_ECOLI/10-233:0.34686,Q9CKC1_PASMU/1-227:0.70879):0.16159,((Q9AB86_CAUCR/7-225:0.80335,Q51565_PSEAE/7-227:0.20586):0.24852,Q9PD97_XYLFA/6-226:0.64812):0.19389);
DTP  (Q9KVL5_VIBCH/4-221,(YIGA_ECOLI/10-233,Q9CKC1_PASMU/1-227),((Q9AB86_CAUCR/7-225,Q51565_PSEAE/7-227),Q9PD97_XYLFA/6-226));
DTL  3.74645
RID  0.246444
RPH  ((((YIGA_ECOLI/10-233:0.71312,Q9CKC1_PASMU/1-227:0.73476):0.43681,Q9KVL5_VIBCH/4-221:0.49497):0.50732,Q51565_PSEAE/7-227:0.45487):0.21730,Q9AB86_CAUCR/7-225:1.43314,Q9PD97_XYLFA/6-226:0.87884);
RTP  ((((YIGA_ECOLI/10-233,Q9CKC1_PASMU/1-227),Q9KVL5_VIBCH/4-221),Q51565_PSEAE/7-227),Q9AB86_CAUCR/7-225,Q9PD97_XYLFA/6-226);
RTL  5.87114
LNK  Q51565_PSEAE/7-227:Q51565:X78478
LNK  Q9AB86_CAUCR/7-225:Q9AB86:AE005708
LNK  Q9CKC1_PASMU/1-227:Q9CKC1:AE006206
LNK  Q9KVL5_VIBCH/4-221:Q9KVL5:AE004103
LNK  Q9PD97_XYLFA/6-226:Q9PD97:AE003977
LNK  YIGA_ECOLI/10-233:P23305:M87049
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PD97_XYLFA/6-226
ASQ  EV-KDKICAYDVAAWLRRHPTFLKQFPDLALTLVVPRENASTASLASYQLEVLREKNRELSRRLAALTGNAQANEQLAMRIHQLTLTLMRQRSAADTLRALVASLAEDFNGDCVRLVLLHPVAG--LQAAWLQVIESDDVRLVPFRDCLRDGEPICGRLNINKQVLLYAE-EASQVQSSALLPLS----G--LGLIAIGSYDPNRFYPGMGTLFLRMMGQALFDALK--RFDV
DSQ  GAGGTG---AAAGATAAGATCTGTGCATACGACGTGGCTGCTTGGCTGCGTCGGCATCCCACTTTTCTTAAACAGTTCCCTGATTTGGCGTTGACGTTGGTGGTGCCTCGTGAAAATGCCTCTACGGCTTCGTTAGCCAGTTACCAACTGGAGGTGTTGCGTGAGAAGAACCGTGAGTTATCGCGCCGACTTGCTGCATTGACGGGCAATGCACAGGCGAATGAGCAGCTGGCCATGCGTATTCATCAATTGACTCTGACGTTGATGCGCCAGAGGAGTGCTGCGGATACGTTACGGGCATTAGTCGCTTCGTTAGCTGAGGATTTTAATGGTGATTGTGTCCGCTTGGTCTTGCTGCACCCGGTTGCAGGG------CTGCAGGCGGCTTGGTTGCAGGTGATTGAGTCCGATGATGTGCGGCTTGTGCCGTTCCGTGATTGCTTGCGGGATGGTGAGCCGATTTGTGGTCGGCTCAACATCAATAAGCAGGTGCTGTTGTATGCCGAA---GAGGCCAGCCAGGTGCAATCCAGTGCGTTATTGCCCTTGTCG------------GGG------TTGGGGTTGATCGCAATTGGTAGTTACGACCCCAATCGCTTTTATCCGGGGATGGGGACGTTGTTTCTACGTATGATGGGGCAGGCGTTGTTCGATGCGCTAAAG------CGTTTCGATGTC
TRN  10010101100011010
NAM  Q9KVL5_VIBCH/4-221
ASQ  VT-ADALTAQVVAEYLYEHPDFFQHHPHLVERLALPTQTG-AVSLAHVQLARQRQRIDSLEEEITALMSLAANNDRTFHEFMDLQEQILKCSSLQAVLHAIEAKARELNLRAYVRLLQRHDEKY--G--------LASEDWQRFATNHFNGKSAYLGRLRQADRQRLLGDRPAPEMGSYVVLPLQ---RQAPLGILAFASEDGGHFQPSMDTLFLRHLALVLAHLIETLPWQS
DSQ  GTAACG---GCGGATGCTCTGACTGCCCAAGTGGTGGCAGAGTATCTTTATGAACATCCCGATTTTTTTCAGCATCATCCTCATCTGGTCGAACGTTTAGCCTTACCGACCCAAACGGGC---GCGGTATCGCTCGCTCATGTGCAGTTAGCGCGTCAGCGCCAGCGGATAGACTCTCTCGAAGAGGAGATCACCGCCTTGATGTCGCTCGCGGCAAATAACGATCGTACTTTCCATGAGTTTATGGATCTGCAAGAGCAGATTCTAAAATGCTCGTCGCTGCAAGCGGTGTTACACGCGATTGAAGCCAAAGCGCGTGAACTCAATCTGCGTGCTTACGTGCGCCTGCTGCAGCGTCATGATGAAAAATAC------GGT------------------------TTAGCCAGTGAGGATTGGCAGCGCTTTGCGACCAATCATTTTAATGGCAAATCGGCTTATTTAGGTCGCTTACGCCAAGCGGATCGGCAACGTCTGCTGGGGGATAGGCCCGCGCCAGAAATGGGTTCGTATGTGGTGTTACCTTTGCAG---------CGCCAAGCGCCGTTGGGAATTTTGGCCTTCGCCAGTGAAGATGGCGGCCACTTTCAGCCGAGTATGGATACCTTGTTTTTGCGCCATCTGGCGTTAGTCTTAGCTCATCTGATCGAGACATTACCTTGGCAGTCA
TRN  10010101100011000
NAM  Q51565_PSEAE/7-227
ASQ  EP-TAALDAEQVAAYLSQHPEFFVEHDELIPELRIPHQPGDAVSLVERQVRLLRERNIEMRHRLSQLMDVARENDRLFDKTRRLVLDLLDATSLEDVVSTVEDSLRHEFQVPYVSLILFSDSSVSVGRS------VSSAEAHQAIGGLLSGGKTVCGVLRPHELAFLFGESDRDEIGSAAVVSLS---FQGLHGVLAIGSPDPQHYKSSLGTLFLGYVAEVLARVLP--RFSS
DSQ  GAACCG---ACAGCAGCGCTGGACGCCGAGCAGGTGGCCGCCTATCTGAGCCAGCACCCGGAGTTCTTCGTCGAGCATGACGAGCTGATCCCCGAGTTGCGCATCCCACACCAGCCCGGCGACGCAGTGTCGCTGGTGGAGCGCCAGGTACGCCTGCTGCGCGAGCGCAACATCGAGATGCGCCACCGGCTCTCGCAACTGATGGACGTGGCCCGCGAGAACGACCGCCTGTTCGACAAGACCCGCCGACTGGTCCTCGACCTGCTCGACGCCACCAGCCTGGAAGACGTGGTCAGTACCGTCGAGGACAGCCTGCGCCACGAGTTCCAGGTGCCCTACGTGAGCCTGATCCTGTTCAGCGACAGTAGCGTCTCGGTGGGCCGCTCG------------------GTGAGCAGCGCGGAGGCGCACCAGGCCATCGGCGGCCTGCTCTCCGGCGGCAAGACCGTCTGCGGCGTGCTGCGTCCGCACGAACTGGCGTTCCTCTTCGGCGAGAGCGACCGCGACGAGATCGGCTCCGCAGCGGTGGTCTCCCTGAGT---------TTCCAGGGCCTGCACGGCGTGCTCGCCATCGGCAGTCCCGATCCGCAGCATTACAAGAGTTCCCTCGGCACCCTGTTCCTCGGCTACGTCGCCGAGGTCCTGGCCCGCGTGCTGCCG------CGTTTCTCCTCG
TRN  11011111101111111
NAM  Q9CKC1_PASMU/1-227
ASQ  MQ-KQSLTPTDIIDYLTQHKDFFLHHPEILDELNLHHTQNNTLSLVEMQLDRQRHRIQELEAELEKFTQLAIQNSDIFLGLLPLQQQLSQAHNLTEGIQKLDQWVKKFELQQ-AKILLFTDAWQK-GESLTDEVWLDRKAFEIVRLERFGLRRFYLGQMTHKEKTMLFLP-EEFPIGSVACCLLGGKTSQKPTALLLFSARDERHFHNGQDTEFLKHLVDIVTLHLG--RWVD
DSQ  ATGCAA---AAACAATCCCTCACCCCAACTGACATCATCGACTACCTGACACAACACAAGGATTTTTTCCTTCATCACCCAGAAATACTGGATGAACTTAACCTCCATCACACACAGAACAATACCCTGTCTTTAGTGGAAATGCAGCTTGACCGTCAGCGTCATCGTATTCAAGAATTAGAAGCGGAGCTGGAGAAATTCACGCAACTTGCTATTCAAAATAGTGATATTTTTCTGGGGTTATTGCCGTTACAACAACAGCTTTCTCAAGCACATAATCTCACAGAAGGGATTCAGAAACTTGATCAGTGGGTGAAAAAATTCGAATTGCAACAA---GCCAAAATCCTCTTATTTACTGATGCGTGGCAGAAA---GGTGAAAGTTTAACGGATGAAGTGTGGCTTGATCGTAAAGCGTTTGAGATAGTACGCTTAGAGCGTTTTGGTTTACGCCGTTTTTATTTGGGGCAAATGACACATAAAGAAAAAACCATGCTATTTTTACCA---GAAGAATTTCCGATTGGTTCGGTCGCCTGTTGTTTGTTAGGTGGAAAAACCTCGCAAAAACCGACCGCACTTTTGTTATTTTCTGCCAGAGATGAGCGTCATTTTCATAATGGGCAAGATACTGAATTTTTGAAACATTTAGTGGATATTGTCACCTTACATTTGGGA------CGATGGGTGGAC
TRN  10010101100011010
NAM  YIGA_ECOLI/10-233
ASQ  ET-LTELDDRAVVDYLIKNPEFFIRNARAVEAIRVPHPVRGTVSLVEWHMARARNHIHVLEENMALLMEQAIANEGLFYRLLYLQRSLTAASSLDDMLMRFHRWARDLGLAG-ASLRLFPDRWRLGAPSNHTHLALSRQSFEPLRIQRLGQEQHYLGPLNGPELLVVLP--EAKAVGSVAMSMLG---SDADLGVVLFTSRDASHYQQGQGTQLLHEIALMLPELLE--RWIE
DSQ  GAAACA---CTCACGGAGCTTGATGACCGGGCGGTTGTCGATTATCTGATTAAAAATCCTGAGTTTTTTATCCGTAATGCGCGCGCAGTAGAAGCGATACGTGTGCCGCATCCGGTACGCGGCACCGTTTCGTTGGTCGAGTGGCACATGGCCCGCGCACGTAATCATATTCATGTTCTGGAAGAGAACATGGCGCTGTTGATGGAACAGGCTATCGCCAACGAAGGCCTGTTTTATCGCCTACTCTACCTGCAGCGCAGTCTCACCGCCGCCAGCAGTCTCGACGATATGCTGATGCGCTTTCACCGCTGGGCGCGCGATCTCGGCCTGGCAGGT---GCGAGTCTGCGCCTGTTTCCGGATCGCTGGCGCTTAGGTGCGCCGTCGAACCACACTCATCTGGCATTAAGCCGTCAGTCTTTCGAACCGCTGCGTATTCAGCGTTTGGGGCAGGAACAGCACTATCTTGGGCCGCTTAACGGACCAGAGCTGCTGGTGGTGCTACCG------GAAGCGAAAGCGGTGGGATCGGTGGCGATGTCGATGCTGGGA---------AGCGATGCTGATTTGGGTGTCGTGCTGTTTACCAGTCGCGATGCCAGTCACTATCAACAAGGGCAAGGAACGCAGTTACTTCATGAAATTGCGCTGATGTTGCCGGAGCTTCTGGAG------CGTTGGATTGAA
TRN  10010101100011010
NAM  Q9AB86_CAUCR/7-225
ASQ  ATRTMVVDPESVRDFLRTEPEFLRQDESLLGELGLRVDAANVVDFGPRALARAAAAHRREASVRQAIEANARANYSAQAQTHAAVIDMLDARNHSDLARRVDEMAQLRFGHAAGVIALEGPSRVP----------AGWRALAESQVDMLLGDAPIARMGFFAPALPLFDD-KAETIRSMAIVRMAIWEPRR-EALIAFGSTDPEGFTPDMGTELVNFLARVVERTAE--RWPV
DSQ  GCGACCAGGACGATGGTCGTGGACCCCGAAAGCGTGCGTGACTTCCTCCGCACCGAGCCGGAATTCCTCCGCCAGGACGAAAGCCTGCTGGGCGAGCTGGGCCTGCGGGTCGACGCGGCCAACGTCGTCGACTTTGGCCCGCGCGCCCTGGCCCGCGCCGCCGCCGCCCATCGTCGGGAGGCCAGCGTCCGGCAGGCCATCGAGGCCAACGCCCGCGCCAATTACTCGGCCCAGGCCCAGACACACGCTGCGGTCATCGACATGCTCGACGCCCGCAACCACTCCGATCTCGCCCGCCGCGTCGATGAGATGGCCCAGTTGCGCTTCGGACATGCCGCCGGCGTGATCGCCCTGGAAGGCCCCAGCCGCGTCCCG------------------------------GCCGGCTGGCGGGCCCTGGCGGAGAGCCAGGTCGATATGCTGTTGGGCGACGCGCCCATCGCGCGCATGGGCTTCTTCGCCCCGGCCCTGCCGCTGTTCGACGAC---AAGGCCGAGACGATTCGCAGCATGGCCATCGTCCGCATGGCGATCTGGGAGCCCCGTCGC---GAGGCGCTGATCGCCTTCGGCTCGACCGACCCCGAAGGCTTCACGCCGGATATGGGCACCGAGCTGGTCAACTTCCTGGCCCGCGTCGTCGAGCGCACGGCCGAA------CGCTGGCCCGTC
TRN  10010101100011011
//