EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04311 - DUF459)
FAM  PF04311
PID  DUF459
DES  Protein of unknown function (DUF459)
IPR  IPR007407
ANO  4
ALN  341
AID  0.191964
APH  (Q9PHQ6_CAMJE/25-330:0.70328,Q9JU60_NEIMA/26-317:0.67777,(Q98H53_RHILO/28-353:2.68631,O83576_TREPA/50-376:1.59148):0.20243);
ATP  (Q9PHQ6_CAMJE/25-330,Q9JU60_NEIMA/26-317,(Q98H53_RHILO/28-353,O83576_TREPA/50-376));
ATL  5.86127
DNO  4
DLN  1023
DID  0.338833
DPH  (Q9PHQ6_CAMJE/25-330:7.55491,(Q98H53_RHILO/28-353:37.58593,Q9JU60_NEIMA/26-317:6.74178):6.48293,O83576_TREPA/50-376:32.33257);
DTP  (Q9PHQ6_CAMJE/25-330,(Q98H53_RHILO/28-353,Q9JU60_NEIMA/26-317),O83576_TREPA/50-376);
DTL  91.1947
RID  0.191964
RPH  (Q9PHQ6_CAMJE/25-330:0.70328,Q9JU60_NEIMA/26-317:0.67777,(Q98H53_RHILO/28-353:2.68631,O83576_TREPA/50-376:1.59148):0.20243);
RTP  (Q9PHQ6_CAMJE/25-330,Q9JU60_NEIMA/26-317,(Q98H53_RHILO/28-353,O83576_TREPA/50-376));
RTL  5.86127
LNK  O83576_TREPA/50-376:O83576:AE001232
LNK  Q98H53_RHILO/28-353:Q98H53:BA000012
LNK  Q9JU60_NEIMA/26-317:Q9JU60:AL162756
LNK  Q9PHQ6_CAMJE/25-330:Q9PHQ6:AL139075
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PHQ6_CAMJE/25-330
ASQ  ISSYIEQKYH--FAFYPHNDLL--KEANGFKIKLEQIRAILS--NEPLPQTNEETTN-QENKSIDENLSKIDKVLNT---LENDENTSHKETNPTLIQDANISFIDNTK--LELQNGDEFLFIGDSLMQGVAIALNRDLRN----LNLKVTDLSKQNTGLSYKSYFDWSKATNEAFIKNSN-IKYLVVLLG--ANDPWD--IKKGGNYHRFGSLSWIDIYTSRVDEIIKIAKK-HKAKVFWFEIPPVKKEDLNKKIQVLNKIYSD------EILKNKEIFIN--TKLFFSV-NDEYSAYIKDENNRSIKVRTDDGVHFTPSG----AREMSKLLLEHIKLK
DSQ  ATTAGCTCTTATATAGAACAAAAATATCAC------TTTGCATTCTATCCTCATAATGATCTTTTA------AAAGAAGCCAATGGCTTCAAAATTAAATTAGAACAAATTCGTGCAATTTTAAGC------AACGAACCCTTGCCTCAAACCAATGAAGAAACTACAAAT---CAAGAAAATAAATCAATAGATGAAAACTTAAGTAAAATAGATAAAGTTCTAAACACT---------TTAGAAAATGATGAAAACACTTCTCATAAAGAAACAAATCCAACCTTAATCCAAGATGCAAATATTAGTTTTATCGACAATACCAAA------TTAGAACTACAAAATGGAGATGAGTTTTTATTTATCGGAGATTCTTTAATGCAAGGTGTTGCAATAGCCTTAAATAGAGATTTAAGAAAT------------TTAAATCTTAAGGTAACCGATCTTAGCAAACAAAATACAGGCCTTTCTTATAAATCCTATTTTGACTGGTCAAAAGCCACCAATGAAGCTTTTATTAAAAACTCAAAT---ATTAAATATCTTGTTGTTCTTCTTGGC------GCTAATGATCCTTGGGAT------ATTAAAAAAGGAGGAAATTACCATCGTTTTGGCTCCCTTTCTTGGATAGATATTTACACAAGTCGTGTAGATGAAATCATTAAAATCGCTAAAAAA---CATAAAGCCAAAGTTTTTTGGTTTGAAATCCCTCCTGTAAAAAAAGAAGATTTGAACAAAAAAATACAAGTGCTCAATAAAATTTACAGCGAT------------------GAAATTCTTAAAAATAAAGAAATTTTTATCAAC------ACTAAGCTATTTTTTAGTGTC---AATGATGAATACTCAGCTTATATAAAAGATGAAAACAATAGAAGTATAAAAGTAAGAACAGATGATGGGGTTCATTTTACTCCAAGTGGC------------GCAAGAGAAATGTCTAAACTTTTATTAGAACACATAAAACTTAAG
TRN  10010101110011000
NAM  Q9JU60_NEIMA/26-317
ASQ  INAYWQQTYHRNSPLEPLAAYG--WWRSGAALQENAYALSDG--IKAFLSGETPPTA-QDGGSADMPS-----------------EAAAPETAP---QTGETEWKQNTEA-AAVRTGDKVFFAGDSLMQGVAPFVQKSLKQQ---YGIESVNLSKQSTGLSYPSFFDWPKTIEETLKKHPE-ISVLAVFLG--PNDPWD--FPVGKRYLKFASDEWAQEYLKRVDRILEAAHT-HYVQVVWLGIPYMKKAKLDGQMRYLDKLLS-------EYLKGKIILIP--TAHTLSG-GKDRYTDSVNVNGKPVRYRSKDGIHFTAEG----QKLLAAKIMEKIVFE
DSQ  ATCAACGCCTACTGGCAGCAGACCTACCACCGCAACAGCCCGCTCGAACCGCTTGCCGCCTACGGA------TGGTGGCGGAGCGGTGCGGCATTGCAAGAAAACGCCTACGCCCTTTCAGACGGC------ATCAAAGCCTTCCTGTCCGGCGAAACGCCGCCGACGGCT---CAAGACGGCGGTTCGGCAGATATGCCGTCT---------------------------------------------------GAAGCCGCCGCACCCGAAACCGCCCCT---------CAAACTGGCGAAACAGAATGGAAACAAAACACCGAAGCC---GCCGCCGTCCGAACAGGGGACAAAGTCTTTTTCGCCGGCGACTCGCTGATGCAGGGCGTTGCACCCTTCGTGCAAAAAAGCCTGAAACAGCAA---------TACGGCATCGAATCCGTCAACCTCAGCAAACAAAGCACGGGGCTGTCCTACCCCTCATTCTTCGACTGGCCGAAAACGATTGAAGAAACCCTGAAAAAACATCCCGAA---ATCAGCGTGCTCGCCGTCTTCCTCGGT------CCGAACGACCCGTGGGAT------TTCCCCGTTGGCAAACGCTACCTCAAATTCGCTTCCGACGAATGGGCGCAAGAATACCTGAAACGCGTCGACCGCATCCTTGAAGCCGCACACACG---CACTACGTCCAAGTCGTCTGGCTCGGCATCCCCTACATGAAAAAAGCCAAGCTCGACGGACAGATGCGCTACCTAGACAAACTGCTTTCG---------------------GAATATTTGAAAGGCAAAATCATCCTGATTCCC------ACCGCGCACACCCTGAGCGGC---GGGAAAGACCGCTACACCGACTCCGTCAACGTCAACGGCAAACCCGTCCGCTACCGCAGCAAGGACGGCATACACTTTACCGCCGAAGGA------------CAAAAACTGCTGGCGGCAAAAATAATGGAAAAAATCGTTTTTGAA
TRN  10010101100011001
NAM  O83576_TREPA/50-376
ASQ  PAVYIRHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWEDTFYHCEQRSYEPAAALAESVPSP--VLQEAVAVSPPGVA--VNDSVAERKTTAPARVFSRTALRILMCGDSQMRYLTGGALQVLGTS---SHVQIQEVTVSSSGFVRTDYYHWPRKFLALLDTHTQQEPYAAVIMAFGMNDYQN-FYDADGSLCVTKTARWERAYEQKMRACLNIILH-TVPKVYLLGMPETRNKQLNEKLVYIEHVQKK---VVAQYDPQRVRYYS--LKPIVPGVHGTYASAIRDTHGRWVHVMHKDGIHYTIEGGAYVMETLLPLILADLERS
DSQ  CCTGCCGTGTACATACGGCACAAGAGCGTGAAAAACATCTACCTTGCATTCGTAGATCCGCTCATGCACACTGCAGAACAGTGGGGAATAGATACGGTATTTCCTCTTTTGCGCGAGAGTTTTTTGCATGCGACAGGTTTGATACAGCATCCGGAGTGGGAAGATACGTTTTATCACTGCGAGCAACGCTCTTATGAGCCAGCTGCTGCCCTGGCGGAGTCTGTGCCTTCTCCT------GTCTTACAGGAGGCCGTGGCCGTTTCCCCTCCGGGGGTGGCG------GTTAACGATTCTGTTGCGGAAAGAAAAACAACTGCTCCCGCACGTGTCTTTTCGCGTACAGCGCTTCGTATTTTGATGTGTGGAGATTCCCAAATGCGTTACCTTACCGGCGGTGCGTTGCAGGTGCTAGGGACGTCT---------TCGCACGTGCAGATTCAAGAAGTGACGGTTAGTTCTTCTGGTTTTGTGCGGACCGATTATTACCACTGGCCACGAAAATTTCTCGCGCTCCTGGATACGCACACCCAACAAGAACCATATGCAGCGGTAATTATGGCATTTGGTATGAATGACTATCAAAAT---TTTTATGATGCGGATGGCTCTTTGTGTGTGACGAAAACTGCACGCTGGGAACGCGCGTATGAGCAAAAAATGCGCGCCTGTTTGAATATTATTCTGCAC---ACAGTACCGAAGGTGTATCTGTTGGGTATGCCAGAGACACGTAACAAACAGTTGAATGAGAAGCTTGTGTACATCGAGCACGTACAAAAGAAA---------GTAGTGGCGCAATACGATCCGCAGCGGGTGCGCTATTACTCC------CTCAAACCAATTGTACCCGGTGTACACGGAACATATGCAAGCGCGATAAGGGACACGCACGGCCGTTGGGTACACGTGATGCACAAAGACGGCATCCACTACACCATAGAGGGTGGTGCGTACGTTATGGAAACTCTCTTACCCCTTATTCTTGCAGATTTGGAACGGTCT
TRN  10010101100011010
NAM  Q98H53_RHILO/28-353
ASQ  PPLDIQKAKP--KPRKPRIPRAPVEPQTPIAEKAPDARIVLV--VGDFMASGLAEG--LDIAFADNPAVRIVARSNGSSGFVRDDFYNWPEQIK---SLIETEKPAAVVV-MLGSNDRQQMKVGDVREQPRSENWTKEYERRTDELGKAIATAKVPFLWVGMP-AFRVPKMTSDMLAFNDI-YHKAAESHGGEFVDVWDGFVDENGAFVTNGPDMNGQPVRLRADDGINVSKAGKRKLAFYTEKPLMKILGLAGPGSVAPATAPAGAPVEAPAPAAAPIVIDRTAPMLLSDPALDGGTELLGAAPPAKANPALPGEKLVIEGK---APEASPGRADDFSWP
DSQ  CCGCCGCTCGACATCCAGAAGGCAAAACCA------AAGCCGCGTAAACCAAGGATACCGCGCGCGCCGGTCGAGCCACAAACACCGATAGCGGAAAAGGCGCCAGACGCTCGCATCGTCCTGGTC------GTCGGCGACTTCATGGCGTCGGGCCTCGCCGAAGGC------CTGGACATAGCCTTTGCCGACAACCCGGCTGTCAGGATCGTCGCGCGCAGCAATGGCTCGTCGGGCTTCGTGCGCGATGATTTCTACAACTGGCCCGAACAGATCAAA---------TCGCTGATTGAGACCGAGAAACCGGCTGCCGTCGTTGTC---ATGCTGGGCTCCAACGACCGCCAGCAGATGAAAGTGGGGGATGTGCGCGAGCAGCCCCGGTCCGAGAACTGGACCAAGGAATATGAGCGCCGCACCGACGAACTCGGCAAGGCCATCGCCACCGCCAAGGTGCCTTTCCTGTGGGTCGGCATGCCA---GCGTTCCGGGTGCCGAAGATGACCTCGGACATGCTGGCCTTCAACGACATC---TACCACAAGGCCGCCGAAAGCCATGGCGGCGAATTCGTCGACGTCTGGGATGGGTTCGTCGACGAGAACGGCGCCTTCGTCACCAACGGCCCCGACATGAACGGCCAGCCGGTGCGGCTGCGCGCCGATGACGGCATCAACGTCTCCAAGGCCGGCAAGCGCAAGCTCGCCTTCTACACCGAAAAGCCGCTGATGAAGATCCTGGGCCTGGCCGGGCCGGGCAGCGTGGCCCCGGCGACGGCACCCGCGGGCGCGCCCGTCGAGGCACCGGCGCCGGCCGCGGCACCTATCGTGATCGACCGTACCGCACCCATGCTGCTCAGCGACCCGGCGCTCGACGGTGGCACCGAACTGCTCGGCGCCGCGCCCCCGGCAAAAGCCAATCCGGCGCTTCCCGGTGAAAAGCTGGTGATCGAAGGCAAG---------GCGCCGGAGGCCTCGCCCGGACGCGCCGACGATTTCTCCTGGCCG
TRN  10010101100011011
//