EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04268 - SoxG)
FAM  PF04268
PID  SoxG
DES  Sarcosine oxidase, gamma subunit family
IPR  IPR007375
ANO  6
ALN  160
AID  0.276802
APH  ((SOXG_CORS1/47-196:0.69397,Q9HTE5_PSEAE/53-204:0.69682):0.23738,(Q986L5_RHILO/64-213:0.69926,(Q98KX5_RHILO/40-189:0.71707,Q989Y3_RHILO/26-172:0.94638):0.26853):0.23773,Q98GZ2_RHILO/47-191:0.69407);
ATP  ((SOXG_CORS1/47-196,Q9HTE5_PSEAE/53-204),(Q986L5_RHILO/64-213,(Q98KX5_RHILO/40-189,Q989Y3_RHILO/26-172)),Q98GZ2_RHILO/47-191);
ATL  5.19121
DNO  6
DLN  480
DID  0.437206
DPH  ((SOXG_CORS1/47-196:0.42058,Q9HTE5_PSEAE/53-204:0.40025):0.11222,Q98GZ2_RHILO/47-191:0.48940,((Q98KX5_RHILO/40-189:0.39646,Q989Y3_RHILO/26-172:0.71752):0.08183,Q986L5_RHILO/64-213:0.59784):0.06647);
DTP  ((SOXG_CORS1/47-196,Q9HTE5_PSEAE/53-204),Q98GZ2_RHILO/47-191,((Q98KX5_RHILO/40-189,Q989Y3_RHILO/26-172),Q986L5_RHILO/64-213));
DTL  3.28257
RID  0.276802
RPH  ((SOXG_CORS1/47-196:0.69397,Q9HTE5_PSEAE/53-204:0.69682):0.23738,(Q986L5_RHILO/64-213:0.69926,(Q98KX5_RHILO/40-189:0.71707,Q989Y3_RHILO/26-172:0.94638):0.26853):0.23773,Q98GZ2_RHILO/47-191:0.69407);
RTP  ((SOXG_CORS1/47-196,Q9HTE5_PSEAE/53-204),(Q986L5_RHILO/64-213,(Q98KX5_RHILO/40-189,Q989Y3_RHILO/26-172)),Q98GZ2_RHILO/47-191);
RTL  5.19121
LNK  Q986L5_RHILO/64-213:Q986L5:BA000012
LNK  Q989Y3_RHILO/26-172:Q989Y3:BA000012
LNK  Q98GZ2_RHILO/47-191:Q98GZ2:BA000012
LNK  Q98KX5_RHILO/40-189:Q98KX5:BA000012
LNK  Q9HTE5_PSEAE/53-204:Q9HTE5:AE004954
LNK  SOXG_CORS1/47-196:Q46338:U23955
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9HTE5_PSEAE/53-204
ASQ  RGDAAD-PAFAAAVHQALGLELPVALTLVASGET--SLQWLAPDEWLLIVPGGEEYAV-EQRLRQALGEELHYAVVNVSGGQTLLELSGANVRELLMKSTSYDVHPSNFPVGKAVGSIFAKSQCVIR----HTGEDTWELVVRRSFADYFWLWLQDASAE
DSQ  CGCGGCGATGCCGCCGAC---CCGGCCTTCGCCGCCGCCGTGCACCAGGCCCTCGGCCTGGAACTGCCGGTGGCCCTGACCCTGGTCGCCAGCGGCGAGACC------TCGCTGCAATGGCTGGCCCCGGACGAATGGTTGCTGATCGTCCCCGGCGGCGAGGAATACGCCGTC---GAACAGCGCCTGCGCCAGGCCCTGGGCGAGGAGCTGCACTACGCGGTGGTCAACGTCAGCGGCGGGCAGACGCTGCTCGAACTGAGCGGAGCGAACGTCCGCGAACTGCTGATGAAATCCACCAGCTACGACGTGCATCCGAGCAACTTCCCGGTGGGCAAGGCGGTCGGCAGCATCTTCGCCAAGTCGCAATGCGTGATCCGC------------CATACCGGCGAGGACACCTGGGAGCTGGTCGTGCGCCGCAGCTTCGCCGACTACTTCTGGCTCTGGTTGCAGGACGCCAGCGCCGAA
TRN  11011101101011011
NAM  SOXG_CORS1/47-196
ASQ  RAVPGS--GGFAALAEAVGTGLPQQVGVVAGSVEGTAVLWLGPDEFLAIAP--EGAEL-AAELVAALGDEPG-QVLDLSANRSVLELSGPAAPLVLRKSCPADLHPRAFGVNLAITTTLANIPVLLW----RTGEQSWYILPRASFTEHTVHWLIDAMSE
DSQ  CGCGCGGTGCCTGGCAGC------GGCGGATTCGCCGCGCTGGCAGAAGCCGTCGGCACCGGGCTGCCGCAGCAGGTCGGGGTGGTCGCAGGCTCCGTGGAGGGCACCGCGGTGCTCTGGCTCGGACCGGACGAGTTCCTGGCCATCGCGCCG------GAAGGCGCGGAACTT---GCCGCAGAGCTGGTTGCGGCGCTGGGGGACGAGCCCGGC---CAGGTTCTGGACCTTTCGGCCAACCGCAGTGTGCTTGAACTGTCCGGACCGGCCGCGCCGCTGGTGCTGCGCAAGAGCTGCCCGGCGGACCTGCACCCGCGCGCCTTCGGCGTCAACCTCGCCATCACCACCACGCTGGCGAACATCCCGGTGCTGCTGTGG------------CGCACCGGCGAGCAGTCCTGGTACATCCTGCCGCGCGCCTCGTTCACCGAGCACACCGTGCACTGGCTGATCGACGCGATGAGCGAA
TRN  11011111101111111
NAM  Q98GZ2_RHILO/47-191
ASQ  RA-PE---ASVTALSKALRLALPNKPKTSASKG-GRTALWLGPDEWLVID---EGGNDPLADCAEVTA--LH-SAVGISHRNIAISVTGPAAEATINSGCPQDLSLDAFPVGAASRTILGKAEIVLL----RTADDAFRVECWRSFSDYVFTFLSEGARD
DSQ  CGCGCG---CCGGAG---------GCTTCGGTAACGGCGCTTTCCAAGGCGCTTCGCCTGGCCTTGCCGAACAAGCCGAAGACTTCGGCGTCGAAGGGA---GGGCGTACTGCTCTGTGGCTCGGCCCCGACGAGTGGCTTGTCATCGAC---------GAGGGCGGAAACGATCCGCTCGCCGATTGCGCAGAGGTTACCGCG------CTGCAT---TCGGCCGTCGGCATCTCGCATCGTAACATCGCGATCTCCGTCACCGGTCCGGCGGCCGAAGCCACGATCAATTCGGGCTGCCCGCAGGACCTGTCGCTCGACGCCTTCCCGGTGGGCGCGGCTTCGCGCACCATCCTCGGCAAGGCCGAGATCGTGCTGTTG------------CGCACGGCTGACGACGCCTTCCGGGTCGAGTGCTGGCGTTCGTTCTCGGACTATGTCTTTACTTTCCTGTCCGAGGGAGCCCGCGAC
TRN  11011111101111111
NAM  Q986L5_RHILO/64-213
ASQ  RGKAAE-MAKAAKGRFSVAA--PETPKAVGTQDA--TLIWSGPDQFFVLS--QGGKHA-MAALASSFAG-SA-SLSDQSHARVLISISGAKARAMLAKLSSIDLHADAFAIGAAAATSMDHTSVTLWRGADRDGSAVFNVLVFATFAESLWHTMLDSAAE
DSQ  CGCGGCAAGGCGGCGGAG---ATGGCCAAGGCTGCCAAGGGCAGGTTTAGTGTTGCGGCT------CCGGAAACGCCAAAGGCAGTCGGCACGCAGGACGCA------ACATTGATCTGGTCGGGACCTGATCAGTTTTTTGTCCTGTCA------CAGGGTGGCAAGCACGCG---ATGGCCGCGCTCGCTTCTTCCTTTGCCGGT---TCGGCT---TCACTCTCCGACCAATCGCATGCGCGGGTGCTGATCAGCATCTCAGGCGCTAAGGCGCGGGCGATGTTGGCCAAGCTGTCGTCGATCGATCTGCATGCGGATGCGTTCGCGATTGGCGCGGCTGCTGCGACTTCGATGGACCACACCAGCGTCACGCTCTGGCGTGGCGCTGACCGAGATGGATCGGCCGTGTTCAACGTTCTAGTGTTTGCGACCTTCGCCGAGAGCCTGTGGCACACGATGCTGGACTCGGCCGCGGAG
TRN  10010101100011001
NAM  Q989Y3_RHILO/26-172
ASQ  KALPEG--AIVHVLAAPREQDLASFLVGLGKGH----VHAVSPGQWFIVGDEPMTYSS-MKALFEMLEP-RA-TGVDQSGGRVRIRIDGRQSERILSTGTAIDLSAESFRVGQSATTLIGHIAAHIT----RIGSDSFELIVLRSFAESLWDDLTRVSAG
DSQ  AAGGCGCTACCCGAAGGC------GCGATCGTCCATGTGCTTGCCGCGCCCCGAGAACAGGACCTGGCATCCTTCCTGGTCGGACTTGGCAAAGGCCAC------------GTCCATGCCGTTTCGCCAGGGCAGTGGTTTATCGTTGGCGACGAGCCGATGACGTATTCCTCT---ATGAAGGCCTTGTTCGAGATGCTCGAACCG---CGCGCG---ACAGGCGTCGACCAGAGCGGCGGCCGCGTCCGTATCCGCATCGACGGCAGACAATCCGAGCGCATCCTATCAACGGGTACGGCCATCGACCTTTCTGCCGAGTCTTTTCGCGTCGGCCAATCAGCAACAACCCTGATCGGCCACATCGCCGCGCACATCACC------------CGCATCGGCAGCGACTCCTTCGAACTAATTGTGCTCAGGAGCTTCGCGGAAAGCCTTTGGGATGATCTCACAAGGGTCAGCGCTGGG
TRN  10010101100011001
NAM  Q98KX5_RHILO/40-189
ASQ  AAWPGEEKNLIATIRTVTGLTLPDGAGGGSSDG-VKSVFGFAPGKFTVAD---EAEGL-AAAFAKAVTPALG-TVTDLSHGRTAIRIAGPKAEWVLAKFFAIDFALPAFPVGAGRSTAHHDVFAQIQ----RTGADQFDIYVFRSFARSFWKALCHASEE
DSQ  GCCGCCTGGCCGGGCGAGGAGAAGAACCTGATCGCGACCATCCGCACCGTCACCGGGCTGACGCTGCCCGACGGCGCAGGCGGGGGCTCGAGCGACGGC---GTGAAATCGGTGTTCGGCTTCGCGCCTGGAAAATTCACAGTGGCCGAT---------GAGGCAGAAGGGCTG---GCCGCTGCCTTCGCCAAGGCGGTGACGCCGGCCCTCGGC---ACGGTGACGGACCTGTCGCATGGCCGCACCGCCATCCGCATCGCCGGGCCGAAGGCCGAATGGGTGCTGGCGAAATTCTTCGCCATCGACTTCGCGCTGCCGGCCTTCCCGGTCGGCGCCGGCCGCTCGACCGCCCATCACGATGTCTTCGCCCAGATTCAG------------CGCACCGGCGCCGACCAGTTCGACATCTATGTCTTCCGCTCCTTCGCGCGCTCATTCTGGAAGGCGCTCTGCCATGCCAGCGAGGAA
TRN  11011101101011001
//