EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04232 - SpoVS)
FAM  PF04232
PID  SpoVS
DES  Stage V sporulation protein S (SpoVS)
IPR  IPR007347
ANO  5
ALN  86
AID  0.619542
APH  (((SP5S_BACSU/1-86:0.11650,Q97IA2_CLOAB/1-86:0.23090):0.15718,Q9X0E9_THEMA/1-86:0.08236):0.12132,Q9WZZ9_THEMA/1-86:0.35177,Q9RTU5_DEIRA/10-95:0.48366);
ATP  (((SP5S_BACSU/1-86,Q97IA2_CLOAB/1-86),Q9X0E9_THEMA/1-86),Q9WZZ9_THEMA/1-86,Q9RTU5_DEIRA/10-95);
ATL  1.54369
DNO  5
DLN  258
DID  0.593023
DPH  (((SP5S_BACSU/1-86:0.18359,Q97IA2_CLOAB/1-86:0.28794):0.20460,Q9X0E9_THEMA/1-86:0.13296):0.07592,Q9WZZ9_THEMA/1-86:0.26849,Q9RTU5_DEIRA/10-95:0.39985);
DTP  (((SP5S_BACSU/1-86,Q97IA2_CLOAB/1-86),Q9X0E9_THEMA/1-86),Q9WZZ9_THEMA/1-86,Q9RTU5_DEIRA/10-95);
DTL  1.55762
RID  0.619542
RPH  (((SP5S_BACSU/1-86:0.11650,Q97IA2_CLOAB/1-86:0.23090):0.15718,Q9X0E9_THEMA/1-86:0.08236):0.12132,Q9WZZ9_THEMA/1-86:0.35177,Q9RTU5_DEIRA/10-95:0.48366);
RTP  (((SP5S_BACSU/1-86,Q97IA2_CLOAB/1-86),Q9X0E9_THEMA/1-86),Q9WZZ9_THEMA/1-86,Q9RTU5_DEIRA/10-95);
RTL  1.54369
LNK  Q97IA2_CLOAB/1-86:Q97IA2:AE007684
LNK  Q9RTU5_DEIRA/10-95:Q9RTU5:AE002008
LNK  Q9WZZ9_THEMA/1-86:Q9WZZ9:AE001755
LNK  Q9X0E9_THEMA/1-86:Q9X0E9:AE001766
LNK  SP5S_BACSU/1-86:P45693:U27501
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RTU5_DEIRA/10-95
ASQ  PEILKVSADSRPHSVAGAIAALLRSQGRVEVQAIGPAAVNQAVKALAIARGYLTEDGLDLSTQPAFVKLEVEQEERTAIKLGVYAY
DSQ  CCCGAAATCCTGAAAGTCTCTGCCGATTCGCGTCCTCATTCGGTGGCCGGTGCCATCGCCGCGCTGCTGCGCTCGCAGGGGCGGGTGGAGGTGCAGGCCATCGGCCCGGCGGCGGTCAACCAGGCGGTCAAGGCGCTCGCCATCGCACGGGGCTACCTCACCGAGGACGGCCTCGACCTCAGCACCCAGCCGGCCTTCGTCAAACTCGAAGTCGAGCAGGAGGAGCGCACCGCCATCAAGCTCGGGGTCTACGCCTAC
TRN  11011101101011011
NAM  SP5S_BACSU/1-86
ASQ  MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDLICIPAFTDIQIDGEERTAIKLIVEPR
DSQ  ATGGAAATCTTAAAAGTTTCAGCAAAATCGAGTCCAAATTCAGTGGCAGGTGCGCTTGCAGGCGTGTTGAGAGAGCGAGGAGCCGCCGAGATTCAAGCGATCGGAGCGGGTGCATTAAACCAGGCTGTAAAAGCTGTGGCGATTGCCAGGGGATTTGTGGCGCCAAGCGGCGTTGATTTGATTTGTATTCCGGCTTTTACAGATATTCAAATCGATGGGGAAGAAAGAACAGCGATTAAATTAATCGTGGAGCCTCGC
TRN  10010101110011000
NAM  Q9X0E9_THEMA/1-86
ASQ  MEVLKVSSKSDPNKVAGAIAGVVREHGKAEIQAIGAGAVNQAVKAIAIARGYLAPSGIDLVFVPAFTDVEIENEKRTAIKFIVFPK
DSQ  ATGGAAGTACTGAAGGTATCGTCGAAGTCCGATCCTAACAAGGTCGCTGGTGCTATTGCCGGTGTGGTGAGGGAGCACGGTAAAGCGGAGATTCAGGCCATTGGAGCCGGTGCAGTGAACCAGGCAGTGAAGGCCATCGCCATTGCGCGGGGGTACCTGGCACCGAGTGGTATCGATCTCGTTTTCGTTCCTGCCTTCACGGACGTCGAGATCGAAAACGAAAAGCGGACAGCCATCAAGTTCATAGTCTTTCCAAAA
TRN  10010101100011011
NAM  Q97IA2_CLOAB/1-86
ASQ  MEVLKVSAKSQPKSVAGALAAVLRNSNSAEVQAVGAGAINQAVKAIAITRGFVAPNGIDLVVVPAFAEISIEGEDRTAIKFIVESR
DSQ  ATGGAAGTATTAAAAGTATCAGCTAAATCTCAACCTAAATCCGTAGCAGGTGCATTAGCAGCAGTTCTTAGAAATAGTAATTCTGCTGAAGTACAGGCGGTAGGAGCTGGAGCTATAAATCAAGCAGTAAAAGCCATAGCAATAACTAGAGGATTTGTAGCTCCTAATGGAATTGATCTTGTTGTTGTTCCAGCCTTTGCTGAAATATCTATTGAAGGCGAAGATAGAACAGCAATAAAATTTATAGTTGAATCAAGA
TRN  10010101110011000
NAM  Q9WZZ9_THEMA/1-86
ASQ  MEILKVSSNSNPNKVAGAIAGSLTKSEKVEIQAIGAGAVNQAVKALAVARRFLEESGKDLFVVPGFIEIKIGDDVRTGISFKVFLE
DSQ  ATGGAAATCCTGAAGGTCAGTTCGAACTCGAACCCCAACAAGGTAGCCGGTGCGATAGCGGGTTCTCTTACCAAGAGCGAAAAGGTGGAGATTCAGGCTATCGGTGCTGGTGCAGTGAACCAGGCAGTAAAGGCTCTGGCAGTCGCAAGGAGATTTCTGGAAGAGTCTGGCAAGGACCTCTTCGTTGTACCGGGTTTCATTGAAATCAAAATAGGGGATGATGTGAGAACAGGTATTTCTTTCAAAGTCTTTCTGGAA
TRN  10010101100011011
//