EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04223 - CitF)
FAM  PF04223
PID  CitF
DES  Citrate lyase, alpha subunit (CitF)
IPR  IPR006472
ANO  5
ALN  468
AID  0.635857
APH  ((Q9KTT9_VIBCH/66-531:0.19049,(Q9CGA7_LACLA/46-510:0.30061,Q99ZK7_STRPY/45-510:0.25717):0.24186):0.06779,CILA_ECOLI/43-508:0.14371,CILA_HAEIN/33-498:0.16036);
ATP  ((Q9KTT9_VIBCH/66-531,(Q9CGA7_LACLA/46-510,Q99ZK7_STRPY/45-510)),CILA_ECOLI/43-508,CILA_HAEIN/33-498);
ATL  1.36199
DNO  5
DLN  1404
DID  0.608468
DPH  (((CILA_ECOLI/43-508:0.18094,CILA_HAEIN/33-498:0.26193):0.06156,Q9KTT9_VIBCH/66-531:0.22039):0.19108,Q9CGA7_LACLA/46-510:0.27198,Q99ZK7_STRPY/45-510:0.27002);
DTP  (((CILA_ECOLI/43-508,CILA_HAEIN/33-498),Q9KTT9_VIBCH/66-531),Q9CGA7_LACLA/46-510,Q99ZK7_STRPY/45-510);
DTL  1.4579
RID  0.635857
RPH  ((Q9KTT9_VIBCH/66-531:0.19049,(Q9CGA7_LACLA/46-510:0.30061,Q99ZK7_STRPY/45-510:0.25717):0.24186):0.06779,CILA_ECOLI/43-508:0.14371,CILA_HAEIN/33-498:0.16036);
RTP  ((Q9KTT9_VIBCH/66-531,(Q9CGA7_LACLA/46-510,Q99ZK7_STRPY/45-510)),CILA_ECOLI/43-508,CILA_HAEIN/33-498);
RTL  1.36199
LNK  CILA_ECOLI/43-508:P75726:U00096
LNK  CILA_HAEIN/33-498:P44459:U32688
LNK  Q99ZK7_STRPY/45-510:Q99ZK7:AE006559
LNK  Q9CGA7_LACLA/46-510:Q9CGA7:AE006351
LNK  Q9KTT9_VIBCH/66-531:Q9KTT9:AE004165
AMK  .xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q99ZK7_STRPY/45-510
ASQ  dSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIANVH-EPLIDHIKNGVVTNITSSGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTKGKATCGSLGYAMIDAKYADQVVILTDNLVPYPNTPISIPQTDVDYVVTVDAIGDPQGIAKGATRFTKNPKELLIAEYAAKVITNSPYFKEGFSFQTGTGGASLAVTRFMREAMIKENIKASFALGGITNAMVELLEEELVEKILDVQDFDHPSAVSLGKHAEHYEIDANMYASPLSKGAVINQLDTCILSALEVDTNFNVNVMTGSDGVIRGASGGHCDTAFAAKMSLVISPLIRGRIPTFVDEVNTVITPGTSVDVIVTEVGIAINPNRQDLVDHFKSLN-VPQFSIEELKEKAYAIVGTPERIQYGDKVVALIEYRDGSLMDVVYNV
DSQ  gatTCTAAATTACTAGGATCTGTTCGTGAAGCGATTGAAAAAACAGGTTTAACAGATGGCATGACCATTTCTTTCCACCACCATTTCCGTGAAGGGGATTTCATTATGAATATGGTCTTGGAGGAAATTGCCAAAATGGGCATTAAAAACCTGTCTATTGCCCCAAGTTCCATCGCTAATGTACAT---GAGCCTTTGATTGATCACATCAAAAATGGTGTGGTCACTAACATCACTTCATCTGGTCTTCGTGACAAAGTAGGGGCAGCCATCTCAGAAGGACTAATGGAAAATCCTGTGGTTATTCGCTCCCATGGTGGTCGCGCTCGTGCCATTGCTAGTGGGGATATCCATATTGATGTTGCCTTTCTGGGCGCCCCAAGTTCAGATGCTTACGGAAATGTTAATGGGACAAAAGGGAAAGCAACCTGTGGTTCTTTGGGCTATGCCATGATTGATGCCAAATATGCGGATCAGGTGGTTATCTTGACAGATAATTTGGTTCCTTATCCTAATACCCCAATCAGCATTCCTCAAACAGATGTTGACTATGTGGTAACAGTGGATGCTATCGGAGATCCTCAAGGAATCGCCAAAGGGGCAACTCGTTTTACGAAAAATCCTAAAGAACTCTTAATTGCAGAATACGCCGCTAAAGTAATCACCAACTCTCCTTATTTTAAAGAAGGATTCTCTTTCCAAACTGGAACAGGTGGCGCTTCTTTGGCAGTAACCCGTTTCATGCGTGAAGCTATGATTAAAGAAAATATCAAAGCTAGCTTTGCTCTTGGTGGTATTACCAATGCTATGGTGGAGTTGCTCGAAGAAGAACTGGTTGAAAAAATTCTTGATGTCCAAGACTTTGATCACCCATCAGCTGTTTCTCTTGGTAAGCATGCTGAACATTATGAAATTGATGCCAACATGTATGCCTCACCTTTGAGCAAGGGTGCTGTTATCAATCAATTAGACACTTGTATTTTATCAGCCCTTGAAGTTGATACTAACTTCAATGTTAATGTGATGACAGGATCTGACGGCGTGATTCGTGGCGCTTCTGGAGGACACTGCGACACTGCCTTTGCGGCTAAGATGAGTTTGGTTATTTCACCACTTATCCGCGGACGCATCCCAACTTTTGTAGATGAGGTTAATACGGTCATTACACCAGGAACAAGTGTCGATGTGATCGTCACAGAAGTGGGAATTGCCATTAACCCAAATCGTCAAGACTTAGTAGACCATTTCAAATCCCTCAAT---GTGCCACAATTTAGTATTGAGGAGCTAAAAGAGAAGGCTTACGCCATCGTTGGCACACCTGAGCGTATTCAATATGGTGATAAGGTTGTTGCTCTTATTGAATACCGTGACGGTAGCCTCATGGATGTGGTTTACAATGTG
TRN  11011101101011000
NAM  Q9CGA7_LACLA/46-510
ASQ  .NKLVDSLEEVVLKT-VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLTNVMNDILVEAIEKGVVTNITSSGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMDGKAPFGSLGYALMDAQYADTVVAITDSLVSYPNTPASIKQTQVDYVVKIDAVGNPDKIGAGATRFTKDPKELKIASMVNDVIVNSPYFKNGFSFQTGTGGAALAVTRFLRQSMIDHNVKATFGLGGITKPMVDLLEEGLVDKLMDVQDFDGGSAQSMHLNKNQQEIDASWYADPANKGAMVDKLDVVILSALEIDTKFNVNVMSGSDGVIRGAIGGHQD-AGTAKLTIISAPLVRGRIATVVPDVTTVITPGDSIDVLVTEIGIAINPKRTDLLDKLSNIPGLPVYTIEELQKIAEEKLGKPEPLEFTDKVVALIEYRDGSLLDIIREV
DSQ  ...AATAAATTGGTAGATTCGCTGGAAGAAGTGGTTTTGAAAACT---GTTAAAGATGGTATGACCATTTCATTCCACCACCATTTCCGCGAAGGCGACTATGTTTTTAATAAAGTCATGCGCATTATCATTGACCACGGCTTTAAAGATTTGAGGATTGCTCCGTCTTCTTTGACCAATGTCATGAATGATATTTTGGTTGAGGCTATTGAAAAAGGTGTCGTGACAAACATTACTTCATCTGGGATGCGTGGAACTTTGGGCGATGTCGTTTCTCACGGCGCTTTGAAAAATCCTGTTATTTTCCGTTCACATGGTGGTCGTGCGCGTGCTATTGAAACTGGTGAAATTCATATTGACGTGGCTTTCTTGGGTACTCCAAATGCTGACGAAATGGGTAATGCCAACGGCATGGACGGTAAAGCACCATTTGGATCATTGGGTTATGCTTTGATGGATGCTCAATATGCTGACACTGTTGTTGCCATTACTGACAGCCTTGTCAGCTATCCTAATACTCCTGCCTCAATCAAACAAACGCAAGTCGATTACGTGGTTAAGATTGATGCGGTCGGTAATCCTGATAAAATCGGGGCTGGTGCGACTCGTTTCACCAAAGACCCTAAAGAATTGAAAATTGCCTCTATGGTTAATGATGTTATTGTGAATTCGCCTTATTTCAAAAACGGCTTTTCATTCCAAACTGGTACAGGTGGGGCTGCGCTTGCGGTTACTCGTTTCTTGCGCCAATCTATGATTGACCACAATGTCAAGGCCACATTTGGTTTGGGGGGTATTACTAAGCCAATGGTTGATTTGCTGGAAGAAGGCTTGGTTGACAAGCTCATGGACGTGCAAGACTTCGACGGTGGCTCTGCTCAATCCATGCACCTCAACAAAAATCAACAAGAAATCGACGCCTCTTGGTACGCTGACCCTGCCAACAAAGGCGCCATGGTCGATAAGCTTGACGTGGTTATCTTGTCTGCCTTGGAAATTGACACCAAGTTCAACGTTAACGTTATGTCTGGTTCTGACGGTGTCATTCGTGGCGCTATCGGTGGTCACCAAGAC---GCTGGGACAGCTAAATTGACGATTATTTCTGCACCTTTGGTGCGCGGTCGGATTGCGACAGTTGTGCCTGATGTGACGACGGTTATCACGCCTGGTGATTCGATTGACGTTTTGGTCACTGAAATCGGGATAGCTATCAATCCTAAGCGGACAGATTTGCTTGATAAATTGAGCAATATTCCTGGTCTGCCAGTTTACACCATTGAAGAATTGCAAAAAATTGCTGAGGAAAAATTGGGCAAGCCAGAACCGCTGGAATTTACCGACAAGGTGGTTGCCTTAATCGAATACCGTGACGGCAGCTTGCTTGATATCATTCGTGAAGTT
TRN  10010101100011000
NAM  CILA_HAEIN/33-498
ASQ  dRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSH-FPIVEHIKNGVVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFTGKSKCGSLGYARVDAEYADKVVLLTEEFVEYPHHPISIAQDQVDLIVQVEAVGDPKKIGGGATRMTTNPRELLIARKCAEVIFASGYFKDGFSLQTGSGGAALAVTRFLEEKMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLARNPNHIEVSANQYANYSSKGASVERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAIIVAPLVRGRIPTVVENVITCVTPGENVDILVTDHGVAVNPKRPDLIEALSKTD-IPLFTIEQLCERAYSITGKPKEIEFTNKPVAVVRYRDGSVIDTVYQV
DSQ  gatCGCAAACTTTGTACCTCTCTAGAAGAAGCGATTAAACGCTCTGGCTTAAAAGATGGTATGACTGTTTCATTTCATCATGCTTTTCGGGGCGGAGATTTTGTGGTGAATATGGTGATGAATAAAATTGCCGAAATGGGTTTCAAAAATCTGACCCTTGCATCTTCATCTTTAATTGATAGCCAC---TTCCCGATTGTCGAACATATCAAAAATGGCGTGGTCACCAAAATCTATTCTTCTGGTTTACGCGGTGAACTTGCAGAGCAAATCTCTCGCGGTTTATTGAATGAACCTGTAAATATTCATTCTCATGGTGGACGTGTTCACTTAGTAAAATCTGGCGAATTAAAAATTGACGTTGCTTTTTTAGGCGTGCCTTGCTGTGACACATTCGGTAATGCCAATGGATTTACTGGAAAAAGTAAATGCGGCTCTCTAGGCTATGCGCGTGTCGATGCTGAATATGCTGACAAAGTTGTGTTGCTCACAGAGGAATTTGTTGAATACCCGCACCACCCAATCAGCATAGCTCAAGATCAAGTAGATTTAATCGTGCAAGTTGAAGCAGTCGGTGACCCGAAAAAAATTGGTGGTGGTGCAACCCGAATGACTACCAATCCACGCGAATTACTCATTGCGCGTAAATGTGCAGAAGTAATTTTTGCCAGTGGTTATTTTAAAGATGGCTTCTCATTACAAACTGGTTCTGGGGGGGCAGCATTAGCTGTTACACGCTTTCTAGAAGAAAAAATGCGTCGTGAAAATATCACTGCAGATTTCGCACTTGGCGGAATTACTGCAAGTATGGTGGCATTACATGAGGCTGGTCTTATTAAAAAATTATTAGATGTACAAAGCTTTGATTCTGTTGCAGCTGAATCACTTGCCCGTAACCCAAATCATATTGAAGTCTCCGCTAACCAATATGCGAATTACAGTTCCAAAGGCGCATCTGTTGAACGTTTAGATATGGTGATTCTTTCTGCTTTAGAAATCGACACTAAATTTAACGTGAATGTATTGACTGGCTCTGACGGTGTGATTCGCGGTGCATCTGGTGGTCATTGTGATACCGCAGCTTCTGCACAAGTAGCAATCATTGTGGCACCATTAGTTCGTGGTCGTATTCCAACCGTGGTGGAAAACGTGATTACCTGTGTAACACCTGGTGAAAACGTCGATATTCTCGTTACCGATCATGGTGTAGCAGTAAATCCTAAACGTCCAGATTTGATTGAAGCTTTAAGCAAAACAGAC---ATTCCATTGTTTACTATTGAACAACTTTGTGAACGTGCTTACAGCATTACTGGTAAACCAAAAGAAATTGAGTTTACTAATAAACCTGTGGCTGTTGTTCGTTATCGTGATGGTTCGGTGATTGATACGGTGTATCAAGTT
TRN  10010101100011000
NAM  CILA_ECOLI/43-508
ASQ  dRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH-APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAKQVVMLTEELLPYPHNPASIEQDQVDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGASLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARNPNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCDTAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQEAG-IKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQV
DSQ  gatCGCAAACTGTGCGCCAACCTGGAAGAAGCGATTCGTCGCTCTGGTTTACAGGACGGCATGACGGTTTCCTTCCATCACGCTTTCCGTGGCGGTGACCTGACCGTCAATATGGTGATGGACGTCATCGCGAAGATGGGCTTTAAAAACCTGACCCTGGCGTCCAGCTCCCTGAGTGATTGCCAT---GCGCCGCTGGTAGAACACATTCGCCAGGGCGTGGTTACCCGCATTTATACCTCCGGCCTGCGTGGTCCACTGGCGGAAGAGATCTCCCGTGGTCTGCTGGCAGAACCGGTGCAGATCCACTCTCACGGCGGTCGTGTGCATCTGGTACAGAGCGGCGAACTGAATATCGACGTGGCTTTCCTCGGCGTCCCGTCCTGTGATGAATTCGGTAATGCCAACGGCTACACCGGTAAAGCCTGCTGCGGCTCCCTCGGCTATGCAATAGTTGATGCCGACAACGCAAAACAGGTCGTGATGCTTACCGAAGAACTGCTGCCTTATCCGCATAATCCGGCAAGCATTGAGCAAGATCAGGTTGATTTGATCGTCAAAGTTGACCGCGTTGGCGATGCTGCAAAAATCGGCGCTGGCGCGACCCGTATGACCACTAACCCGCGCGAACTGCTTATTGCCCGTAGCGCTGCGGATGTGATTGTCAACTCTGGCTACTTCAAAGAAGGTTTCTCCATGCAAACCGGCACCGGCGGCGCATCGCTGGCGGTAACCCGTTTCCTGGAAGACAAAATGCGTAGCCGCGATATTCGCGCCGACTTCGCCCTTGGCGGTATTACCGCGACGATGGTTGACCTGCACGAAAAAGGTCTGATCCGCAAACTGCTGGATGTGCAGAGCTTTGACAGCCATGCTGCGCAATCGCTGGCCCGTAACCCCAATCACATCGAAATCAGCGCCAACCAGTACGCTAACTGGGGTTCGAAAGGCGCATCGGTTGATCGTCTCGACGTGGTGGTACTGAGCGCGCTGGAAATTGACACCCAGTTCAACGTTAACGTGCTGACCGGCTCTGACGGCGTACTGCGTGGTGCTTCCGGTGGTCACTGCGATACCGCGATTGCCTCTGCGCTTTCCATCATCGTCGCGCCGCTGGTACGCGGTCGTATTCCGACTCTGGTGGATAACGTACTGACCTGCATCACCCCAGGCTCCAGTGTCGATATTCTGGTCACAGACCACGGTATCGCAGTTAACCCGGCACGTCCGGAACTGGCAGAACGTCTGCAGGAAGCGGGC---ATTAAAGTGGTTTCCATTGAGTGGCTGCGCGAACGTGCGCGTCTGCTGACCGGTGAACCACAGCCGATTGAATTCACAGACCGCGTCGTTGCCGTTGTGCGTTACCGCGATGGCTCGGTGATCGATGTTGTGCATCAGGTG
TRN  10010101100011010
NAM  Q9KTT9_VIBCH/66-531
ASQ  sRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCH-SPLIEHIKNGVVSKIYTSGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGKSNCGSLGYAKVDAEHAEKVVMLTEAIVGFPNFPASITQDRVDAVVQVAEVGDPSKIGGDATRMTTNPRELLIAKRAAEVIEHSGYFYDGFSMQTGSGGASLAVARFLKEKMLRQDIRASFALGGITATMVDMHEQGLIDYLLDVQCFDSVAAGSLARNPHHLEISANEYANPSSKGAAVDRLDVVILSALEIDTQFNVNVITGSDGVIRGASGGHCDTAAAANLSIIVAPLVRGRIPTVVEKVTNVITPGSTIDVLVTDQGIAVNPNRPELKARFIEAQ-LPVVEIEALQQRAELLTGKPQPLQFEDKTVAFVHYRDGSIIDVIKQV
DSQ  agcCGCAAAGTGAAAAGCTCGATCCGCGAAGCGATTGTCGATCTTGGCTTAAAAGATGGCATGACCATCTCTTTCCACCATGCGTTTCGTGGCGGCGATAAAACCGTCAATCTGGTGATGGAGGTGATTGCTGAATTGGGAATTAAAAATCTCACGCTCGCCTCAAGCTCGCTGACCTCTTGTCAT---TCGCCTTTGATTGAACACATCAAAAACGGCGTAGTGAGCAAGATTTACACCTCAGGGATCCGCGGAGCGCTGGCCGACAGCATTTCTAACGGCCTGCTTGATGAGCCCGTGCATATTCACTCGCACGGTGGTCGTGTGCATTTGATCCAAAGCGGTGAGCTGTACATCGACATGGCGTTTATTGGCGTACCTTGTTGCGATGAATTTGGTAACGCTAACGGTTTTAAAGGCAAGTCCAATTGTGGCTCACTCGGCTATGCCAAAGTTGATGCCGAGCACGCTGAAAAAGTGGTGATGCTGACCGAAGCGATCGTCGGTTTCCCGAATTTCCCTGCATCGATTACTCAAGATCGTGTTGATGCGGTGGTGCAAGTAGCCGAAGTGGGCGACCCAAGCAAAATCGGTGGGGATGCCACGCGCATGACCACCAACCCACGCGAGCTGTTGATCGCCAAACGCGCTGCGGAAGTCATTGAGCATTCTGGCTATTTCTATGATGGTTTTTCAATGCAGACTGGTTCGGGCGGTGCATCGCTCGCGGTTGCGCGCTTTTTGAAAGAGAAGATGCTGCGCCAAGACATCCGTGCTTCTTTCGCTCTCGGTGGTATCACCGCAACCATGGTCGATATGCATGAGCAGGGGCTGATTGATTACTTGCTCGATGTGCAGTGTTTCGATTCGGTGGCGGCGGGCTCGTTAGCGCGCAATCCGCATCATCTCGAAATCTCTGCTAACGAATACGCCAACCCAAGCTCGAAAGGGGCGGCGGTGGATAGGCTGGATGTGGTTATCTTGAGTGCGCTGGAGATTGATACCCAGTTTAACGTTAACGTGATCACCGGCTCTGATGGGGTAATTCGCGGTGCATCCGGCGGCCACTGCGACACGGCGGCTGCGGCAAACTTATCGATTATTGTGGCGCCTTTGGTGCGTGGCCGCATTCCGACCGTGGTCGAGAAGGTCACTAACGTCATCACCCCAGGATCCACCATTGATGTGTTGGTGACGGATCAAGGTATCGCGGTAAACCCGAATCGTCCCGAACTGAAAGCACGTTTCATCGAGGCGCAA---CTGCCCGTTGTCGAGATTGAAGCGTTGCAACAGCGTGCCGAGTTGCTGACGGGCAAACCCCAGCCGTTGCAATTTGAAGACAAAACCGTTGCCTTTGTTCACTACCGTGACGGTTCGATCATTGATGTTATCAAACAGGTA
TRN  10010101100011000
//