EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04195 - Transposase_28)
FAM  PF04195
PID  Transposase_28
DES  Putative gypsy type transposon
IPR  IPR007321
ANO  2
ALN  184
AID  0.325444
APH  (Q9LG68_ORYSA/1-181:1.05880,Q9AYG4_ORYSA/1-180:0.49496);
ATP  (Q9LG68_ORYSA/1-181,Q9AYG4_ORYSA/1-180);
ATL  1.55377
DNO  2
DLN  552
DID  0.453861
DPH  (Q9LG68_ORYSA/1-181:0.17671,Q9AYG4_ORYSA/1-180:0.81097);
DTP  (Q9LG68_ORYSA/1-181,Q9AYG4_ORYSA/1-180);
DTL  0.98768
RID  0.325444
RPH  (Q9LG68_ORYSA/1-181:1.05880,Q9AYG4_ORYSA/1-180:0.49496);
RTP  (Q9LG68_ORYSA/1-181,Q9AYG4_ORYSA/1-180);
RTL  1.55377
LNK  Q9AYG4_ORYSA/1-180:Q9AYG4:AC078839
LNK  Q9LG68_ORYSA/1-181:Q9LG68:AP002804
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9LG68_ORYSA/1-181
ASQ  MARGSAPLDGSVLPPSRIVSERQAGLPRRFMPESATGREVVALGEGRPTPHYPGRSVFFLSFAMAGLVPPFSSFFMDILEFYDLQMAHLTPNAVMMLAIFAHLCEMFIGVRPSLWLFQWFFTVQL---VSPPLVVGGCYFQPRGQVLNRYIPCVLHKKWDDWKSDWFYTPLADEARLRLPSQPP
DSQ  ATGGCACGGGGCTCCGCACCGCTCGATGGTAGCGTGCTGCCGCCTTCCCGCATCGTGAGCGAGAGGCAGGCCGGGCTGCCGCGCCGATTCATGCCGGAATCTGCCACCGGCCGGGAGGTGGTCGCGCTGGGCGAGGGACGCCCGACGCCACACTACCCGGGGCGGTCCGTCTTCTTCCTCTCTTTCGCAATGGCAGGGCTGGTCCCGCCATTCTCTTCTTTTTTCATGGATATTCTGGAGTTTTATGATCTCCAAATGGCGCACCTCACCCCCAACGCGGTAATGATGTTGGCCATCTTTGCGCACCTGTGCGAGATGTTCATCGGGGTGCGCCCATCTCTCTGGCTGTTCCAGTGGTTCTTCACCGTACAGCTG---------GTGTCGCCGCCGTTAGTAGTCGGTGGCTGCTACTTCCAGCCGCGGGGGCAGGTGCTGAACCGCTACATTCCCTGCGTCCTCCACAAGAAGTGGGACGACTGGAAGAGCGACTGGTTCTACACCCCCCTCGCCGACGAAGCGCGCCTCCGACTTCCGAGCCAGCCCCCG
TRN  10010101100011010
NAM  Q9AYG4_ORYSA/1-180
ASQ  MAEERESFESQWAPSDVTEENLKEMVAHDVLPAKEIIGWRPACGEAFPTPDMH-EVVVFSHFFYDGFSLPTLKFFRGILEFYGISLHHLNPNSIVHIANFIHTCEAFLGIRPHFVLFRRIFFLKPQPNKSKPCVVGGAGFQLRGTLSQKYFSMPFKTSNKGWHANWFYVQNPEPA---LPEYSY
DSQ  ATGGCGGAGGAGAGAGAAAGCTTTGAGAGCCAATGGGCTCCCTCCGATGTTACTGAGGAGAACTTGAAGGAAATGGTGGCGCACGACGTTCTTCCGGCAAAGGAGATCATCGGCTGGCGTCCAGCGTGTGGCGAAGCATTCCCAACTCCTGACATGCAT---GAGGTCGTGGTATTCTCCCATTTCTTCTACGATGGTTTTTCTCTTCCAACTTTGAAATTCTTCAGGGGGATTCTTGAGTTTTATGGGATCAGCTTGCATCATCTTAACCCCAATTCCATAGTCCACATTGCCAACTTTATCCACACCTGTGAAGCCTTTCTAGGGATTAGGCCACATTTTGTCCTGTTCCGCCGCATCTTCTTCCTGAAGCCCCAGCCAAATAAGAGCAAGCCATGCGTTGTTGGGGGTGCCGGTTTTCAGCTAAGGGGCACCCTGAGCCAGAAATATTTCTCTATGCCTTTCAAAACATCAAACAAAGGCTGGCACGCAAACTGGTTTTATGTGCAAAATCCTGAACCGGCG---------CTTCCTGAGTACTCTTAC
TRN  10010101100011001
//