EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04162 - Circo_coat)
FAM  PF04162
PID  Circo_coat
DES  Circovirus coat protein (VP1)
IPR  IPR007291
ANO  22
ALN  449
AID  0.978914
APH  (((((((((Q9IZU5_9CIRC/1-449:0.00669,(Q9DTF3_9CIRC/1-449:0.00223,(Q9DTF4_9CIRC/1-449:0.00000,(Q9DTF2_9CIRC/1-449:0.00223,Q9DTF1_9CIRC/1-449:0.00000):0.00223):0.00223):0.00670):0.00000,Q9DXA7_9CIRC/1-449:0.00223):0.00222,VP1_CAVAU/1-449:0.00223):0.00000,VP1_CAV82/1-449:0.01570):0.00223,Q9JGP0_9CIRC/1-449:0.00447):0.00446,(VP1_CAV26/1-449:0.00671,(((VP1_CAVC1/1-449:0.00000,Q96673_9CIRC/1-449:0.01344):0.00223,Q9YJ45_9CIRC/1-449:0.00000):0.00223,(((Q9YKK7_9CIRC/1-449:0.00671,Q9YKK8_9CIRC/1-449:0.00223):0.00446,O41449_9CIRC/1-449:0.00000):0.00224,(Q9YIV9_9CIRC/1-449:0.00224,Q9YKK6_9CIRC/1-449:0.00000):0.00447):0.00447):0.00223):0.00224):0.00844,Q96674_9CIRC/1-449:0.00428):0.00292,VP1_CAVCI/1-449:0.00223):0.00447,Q96672_9CIRC/1-449:0.00224,Q9WB34_9CIRC/1-449:0.00222);
ATP  (((((((((Q9IZU5_9CIRC/1-449,(Q9DTF3_9CIRC/1-449,(Q9DTF4_9CIRC/1-449,(Q9DTF2_9CIRC/1-449,Q9DTF1_9CIRC/1-449)))),Q9DXA7_9CIRC/1-449),VP1_CAVAU/1-449),VP1_CAV82/1-449),Q9JGP0_9CIRC/1-449),(VP1_CAV26/1-449,(((VP1_CAVC1/1-449,Q96673_9CIRC/1-449),Q9YJ45_9CIRC/1-449),(((Q9YKK7_9CIRC/1-449,Q9YKK8_9CIRC/1-449),O41449_9CIRC/1-449),(Q9YIV9_9CIRC/1-449,Q9YKK6_9CIRC/1-449))))),Q96674_9CIRC/1-449),VP1_CAVCI/1-449),Q96672_9CIRC/1-449,Q9WB34_9CIRC/1-449);
ATL  0.1386
DNO  22
DLN  1347
DID  0.968659
DPH  (Q96673_9CIRC/1-449:0.00448,VP1_CAVC1/1-449:0.00000,((((((VP1_CAVCI/1-449:0.01333,((Q9DTF3_9CIRC/1-449:0.00079,((Q9DTF2_9CIRC/1-449:0.00000,Q9DTF1_9CIRC/1-449:0.00080):0.00080,Q9DTF4_9CIRC/1-449:0.00080):0.00000):0.00975,Q9DXA7_9CIRC/1-449:0.00750):0.00172):0.00298,Q9JGP0_9CIRC/1-449:0.00769):0.00000,(((Q96674_9CIRC/1-449:0.00717,(Q96672_9CIRC/1-449:0.00283,Q9WB34_9CIRC/1-449:0.00389):0.01427):0.01071,(VP1_CAVAU/1-449:0.00282,Q9IZU5_9CIRC/1-449:0.00314):0.03239):0.00757,VP1_CAV82/1-449:0.01507):0.00594):0.00222,VP1_CAV26/1-449:0.01036):0.00822,(((Q9YKK7_9CIRC/1-449:0.00524,Q9YKK8_9CIRC/1-449:0.00079):0.00151,O41449_9CIRC/1-449:0.00151):0.00151,(Q9YIV9_9CIRC/1-449:0.00152,Q9YKK6_9CIRC/1-449:0.00080):0.00300):0.00152):0.00080,Q9YJ45_9CIRC/1-449:0.00000):0.00079);
DTP  (Q96673_9CIRC/1-449,VP1_CAVC1/1-449,((((((VP1_CAVCI/1-449,((Q9DTF3_9CIRC/1-449,((Q9DTF2_9CIRC/1-449,Q9DTF1_9CIRC/1-449),Q9DTF4_9CIRC/1-449)),Q9DXA7_9CIRC/1-449)),Q9JGP0_9CIRC/1-449),(((Q96674_9CIRC/1-449,(Q96672_9CIRC/1-449,Q9WB34_9CIRC/1-449)),(VP1_CAVAU/1-449,Q9IZU5_9CIRC/1-449)),VP1_CAV82/1-449)),VP1_CAV26/1-449),(((Q9YKK7_9CIRC/1-449,Q9YKK8_9CIRC/1-449),O41449_9CIRC/1-449),(Q9YIV9_9CIRC/1-449,Q9YKK6_9CIRC/1-449))),Q9YJ45_9CIRC/1-449));
DTL  0.19625
RID  0.978914
RPH  (((((((((Q9IZU5_9CIRC/1-449:0.00669,(Q9DTF3_9CIRC/1-449:0.00223,(Q9DTF4_9CIRC/1-449:0.00000,(Q9DTF2_9CIRC/1-449:0.00223,Q9DTF1_9CIRC/1-449:0.00000):0.00223):0.00223):0.00670):0.00000,Q9DXA7_9CIRC/1-449:0.00223):0.00222,VP1_CAVAU/1-449:0.00223):0.00000,VP1_CAV82/1-449:0.01570):0.00223,Q9JGP0_9CIRC/1-449:0.00447):0.00446,(VP1_CAV26/1-449:0.00671,(((VP1_CAVC1/1-449:0.00000,Q96673_9CIRC/1-449:0.01344):0.00223,Q9YJ45_9CIRC/1-449:0.00000):0.00223,(((Q9YKK7_9CIRC/1-449:0.00671,Q9YKK8_9CIRC/1-449:0.00223):0.00446,O41449_9CIRC/1-449:0.00000):0.00224,(Q9YIV9_9CIRC/1-449:0.00224,Q9YKK6_9CIRC/1-449:0.00000):0.00447):0.00447):0.00223):0.00224):0.00844,Q96674_9CIRC/1-449:0.00428):0.00292,VP1_CAVCI/1-449:0.00223):0.00447,Q96672_9CIRC/1-449:0.00224,Q9WB34_9CIRC/1-449:0.00222);
RTP  (((((((((Q9IZU5_9CIRC/1-449,(Q9DTF3_9CIRC/1-449,(Q9DTF4_9CIRC/1-449,(Q9DTF2_9CIRC/1-449,Q9DTF1_9CIRC/1-449)))),Q9DXA7_9CIRC/1-449),VP1_CAVAU/1-449),VP1_CAV82/1-449),Q9JGP0_9CIRC/1-449),(VP1_CAV26/1-449,(((VP1_CAVC1/1-449,Q96673_9CIRC/1-449),Q9YJ45_9CIRC/1-449),(((Q9YKK7_9CIRC/1-449,Q9YKK8_9CIRC/1-449),O41449_9CIRC/1-449),(Q9YIV9_9CIRC/1-449,Q9YKK6_9CIRC/1-449))))),Q96674_9CIRC/1-449),VP1_CAVCI/1-449),Q96672_9CIRC/1-449,Q9WB34_9CIRC/1-449);
RTL  0.1386
LNK  O41449_9CIRC/1-449:O41449:U66304
LNK  Q96672_9CIRC/1-449:Q96672:U65414
LNK  Q96673_9CIRC/1-449:Q96673:U69548
LNK  Q96674_9CIRC/1-449:Q96674:U69549
LNK  Q9DTF1_9CIRC/1-449:Q9DTF1:AB046590
LNK  Q9DTF2_9CIRC/1-449:Q9DTF2:AB046589
LNK  Q9DTF3_9CIRC/1-449:Q9DTF3:AB046588
LNK  Q9DTF4_9CIRC/1-449:Q9DTF4:AB046587
LNK  Q9DXA7_9CIRC/1-449:Q9DXA7:AF313470
LNK  Q9IZU5_9CIRC/1-449:Q9IZU5:AF227982
LNK  Q9JGP0_9CIRC/1-449:Q9JGP0:AB031296
LNK  Q9WB34_9CIRC/1-449:Q9WB34:AB027470
LNK  Q9YIV9_9CIRC/1-449:Q9YIV9:AJ133518
LNK  Q9YJ45_9CIRC/1-449:Q9YJ45:AJ133508
LNK  Q9YKK6_9CIRC/1-449:Q9YKK6:AJ133517
LNK  Q9YKK7_9CIRC/1-449:Q9YKK7:AJ133515
LNK  Q9YKK8_9CIRC/1-449:Q9YKK8:AJ133509
LNK  VP1_CAV26/1-449:P54089:D10068
LNK  VP1_CAV82/1-449:P54090:D31965
LNK  VP1_CAVAU/1-449:P54087:S71488
LNK  VP1_CAVC1/1-449:Q99153:M55918
LNK  VP1_CAVCI/1-449:P54088:L14767
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q96673_9CIRC/1-449
ASQ  MARRARRPRGRFYSFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAGNNWPNGCVPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACTCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAAATCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACAAGCCGGGAACAATTGGCCTAATGGCTGCGTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGGACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9YKK6_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGIIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKSLAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWLKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGGAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGATCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAACTGGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACTAGCCGCGGAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCTAAAAGGCGGACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGAACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9YIV9_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGIIFLTEGLILPKNSAAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKSLAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWLKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGGAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGATCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCGCAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAACTGGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACTAGCCGCGGAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGAGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCTAAAAGGCGGACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9YKK8_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRKYRFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKSLAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWQKGQQPMTGGIAYATGKMRPDEQHYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAAATATAGATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACTAGCCGCGGAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCAAAAAGGCCAACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACATTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  O41449_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKSLAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWQKGQQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACTAGCCGCGGAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCAAAAAGGCCAACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCCTGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAGCGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9YKK7_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRKYRFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKSQAADNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWQKGQQPMTGGIAYATGKMRPDDQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAAATATAGATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACAAGCCGCGGACAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCAAAAAGGCCAGCAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGACCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTACCGCTCGGTACTGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9YJ45_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAADNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWQKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAAATCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACAAGCCGCGGACAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCAAAAAGGCGGACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  VP1_CAVC1/1-449
ASQ  MARRARRPRGRFYSFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAADNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWQKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACTCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGGGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCCTCAATGAACCTGACATACGTGAGCAAAATCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACAAGCCGCGGACAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCAAAAAGGCGGACAACCGATGACGGGGGGCATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGTCAGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAACAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  VP1_CAV26/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAAENWPNCWLPLDNNMPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITTTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWETQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGGAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGATTCCAAGGAGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTAAACCTGAAAGAGTTCCTGCTAGCGTCAATGAACCTGACATACGTGAGCAAAATCGGAGGACCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACAAGCCGCGGAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACATGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTTACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGGACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCACTACTACAGCCCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACGCTGGTGCCCCTGGGCACGGAGACCATCACCGACAGCTACATGAGTGCACCCGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAAAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAGCTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCCAACAGCACCATGTACTGGGAGACGCAGCCC
TRN  10010101100011000
NAM  VP1_CAV82/1-449
ASQ  MERRARRPRGRFYAFRRGRWNHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKSEAAENWPNCCVPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGAAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGAACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTAAGGCTGCCGAACCCCCAATCTACGATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCGGTGAACCTGAAAGAGTTCCTACTAGCGTCAATGAACCTGACATACGTGAGCAAACTAGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCAGAAGCCGCGGAGAATTGGCCTAATTGCTGCGTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAACAAATGACCCTGCAAGACATGGGGCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGGGCAACCGATGACGGGGGGGATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGGTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCGCTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCGTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGCCAGAGATGGCACACGCTGGTGCCACTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCGGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATTCATGGGCAGTGGTACGCGTCCAGTCGGTGTGGCAACTGGGTAACAGACAGAGGCCATACCCATGGGACGTCAACTGGGCGAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9IZU5_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRLDEQQYPAMPPDPPIITTTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMRAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCAAACCCCCAGTCCACGATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACCGAAGGACTCATTCTACCTAAAAACAGCACAGCTGGGGGCTATGCGGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCAGTGAACCTGAAAGAGTTCCTCCTAGCATCAATGAACCTGACATACGTGAGCAAGATAGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCGCAAGCCGCGGAGAACTGGCCAAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCTGCATGGTGGAGATGGGCTTTAATGATGATGCAGCCAACGGACTCCTGCCGGTTTTTTAATCACCCTAAGCAAATGACCCTGCAAGACATGGGTCGGATGTTTGGGGGCTGGCATCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGCCGCGACGATGTTAAGTACAGCAGCGACCACCAGAACCGGTGGCGAAAAGGCGAGCAACCGATGACGGGGGGGATTGCTTACGCGACCGGTAAAATGAGACTCGACGAGCAACAATACCCTGCTATGCCCCCGGACCCCCCGATCATCACCACTACCACTGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCGTGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCTCAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCATCACAAGGCCCGAGGAGCCGGGGACCCCAAGGGCCAGAGGTGGCACACGCTGGTGCCGCTCGGCACAGAGACCATAACCGACAGCTACATGAGAGCACCGGCATCAGAGCTGGACACGAATTTCTTCACGCTTTACGTAGCGCAAGGCACTAATAAATCGCAGCAATACAAGTTCGGCACAGCAACATACGCGCTAAAGGAACCCGTAATGAAGAGCGATTCATGGGCAGTGGTGCGCGTCCAGTCCGTCTGGCAACTGGGTAACAGGCAAAGGCCATACCCGTGGGACGTTAACTGGGCCAACAGCACCATGTACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q9JGP0_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSEAAENWPNCWLPLDNNMPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACCATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCGTCAATGAACCTGACATACGTGAGCAAAATCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCAGAAGCCGCGGAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACATGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAGATGACCCTGCAAGATATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCAGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGATACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCCGCATCAGAGCTGGACACTAATTTTTTTACGCTTTACGTAGCGCAAGGCACAAATAAATCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTGCGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAGAGGCCATACCCATGGGACGTAAACTGGGCCAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9DXA7_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGGQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACCATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACAGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCGTCAATGAACCTGACATACGTGAGCAAAATCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCACAAGCCGCGGAGAACTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTATTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAATACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACCCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCCGCATCAGAGCTGGACACAAATTTCTTTACGCTTTACGTAGCGCAAGGTACAAATAAGTCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATTCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAGAGACCATACCCATGGGACGTCAACTGGGCCAACAGCACCATGTACTGGGGCGGGCAGCCC
TRN  10010101100011000
NAM  VP1_CAVAU/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMYSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCAAACCCCCAGTCCACGATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACCGAAGGACTCATTCTACCTAAAAACAGCACAGCTGGGGGCTATGCGGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCAGTGAACCTGAAAGAGTTCCTCCTAGCATCAATGAACCTGACATACGTGAGCAAGATAGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAATCGCAAGCCGCGGAGAACTGGCCAAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCTGCATGGTGGAGATGGGCTTTAATGATGATGCAGCCAACGGACTCCTGCCGGTTTTTTAATCACCCTAAGCAAATGACCCTGCAAGACATGGGTCGGATGTTTGGGGGCTGGCATCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGCCGCGACGATGTTAAGTACAGCAGCGACCACCAGAACCGGTGGCGAAAAGGCGAGCAACCGATGACGGGGGGGATTGCTTACGCGACCGGTAAAATGAGACCCGACGAGCAACAATACCCTGCTATGCCCCCGGACCCCCCGATCATCACCAGTACCACAGCGCAAGGCACGCAAGTCCGCTGCATGTATAGCACGCAAGCTTGGTGGTCGTGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCTCAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGATCGTTCAACCATCACAAGGCCCGAGGAGCCGGGGACCCCAAGGGCCAGAGGTGGCACACGCTGGTGCCGCTCGGCACAGAGACCATAACCGACAGCTACATGGGAGCACCGGCATCAGAGCTGGACACGAATTTCTTCACGCTTTACGTAGCGCAAGGCACTAATAAATCGCAGCAATACAAGTTCGGCACAGCAACATACGCGCTAAAGGAACCCGTAATGAAGAGCGATTCATGGGCAGTGGTGCGCGTCCAGTCCGTCTGGCAACTGGGTAACAGGCAAAGGCCATACCCGTGGGACGTTAACTGGGCCAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  Q9DTF1_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKAQAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASEIDTNFFTLYVAQGTNKSQHYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMDWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACAGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTAAACCTGAAGGAGTTCCTGCTAGCGTCAATGAACCTAACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAAGCACAAGCCGCGGAGAACTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAAATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATAATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCATAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCCGCATCAGAGATAGACACGAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCACTACAAGTTCGGCACAGCTACATACGCGCTGAAGGAGCCGGTAATGAAGAGCGATTCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCTTACCCATGGGACGTCAACTGGGCCAACAGCACCATGGACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q9DTF4_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKAQAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASEIDTNFFTLYVAQGTNKSQHYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACAGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTAAACCTGAAGGAGTTCCTGCTAGCGTCAATGAACCTAACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAAGCACAAGCCGCGGAGAACTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAAATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATAATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCATAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCCGCATCAGAGATAGACACGAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCACTACAAGTTCGGCACAGCTACATACGCGCTGAAGGAGCCGGTAATGAAGAGCGATTCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCTTACCCATGGGACGTCAACTGGGCCAACAGCACCATGTACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q9DTF2_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKAQAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASEIDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMDWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACAGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTAAACCTGAAGGAGTTCCTGCTAGCGTCAATGAACCTAACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAAGCACAAGCCGCGGAGAACTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAAATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATAATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCATAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCCGCATCAGAGATAGACACGAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTGAAGGAGCCGGTAATGAAGAGCGATTCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCTTACCCATGGGACGTCAACTGGGCCAACAGCACCATGGACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q9DTF3_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKLGGPIAGELIADGSKAEAAENWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITSTTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMGAPASEIDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDSWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGAGTCATCTTTCTCACAGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACATGTACGGGGCGAGAGTCGCCAAGATCTCTGTAAACCTGAAGGAGTTCCTGCTAGCGTCAATGAACCTAACATACGTGAGCAAACTCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTAAAGCAGAAGCCGCGGAGAACTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAGCAAATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATAATCACCAGTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCATAAGGCGAGAGGAGCCGGGGACCCCAAAGGCCAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGGGAGCACCCGCATCAGAGATAGACACGAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTGAAGGAGCCGGTAATGAAGAGCGATTCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCTTACCCATGGGACGTCAACTGGGCCAACAGCACCATGTACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q9WB34_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGIIFLTEGLILPKNSTAGGYADHLYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSQSQAAQNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDIKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITTTTPQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCAGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTACCGAACCCCCAGTCAACGATGACTATCCGCTTTCAAGGAATCATTTTTCTTACCGAAGGACTCATTCTACCTAAAAACAGTACAGCGGGGGGATATGCAGACCACCTCTACGGGGCGAGAGTCGCCAAGATCTCAGTGAACCTGAAAGAGTTCCTCCTAGCGTCAATGAACCTGACATACGTGAGCAAAATAGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTCAATCACAAGCCGCGCAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCTTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCAAAGCAAATGACCCTGCAAGACATGGGTCGGATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATATTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAGCAACCGATGACGGGGGGTATTGCTTATGCGACGGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCCGACCCCCCGATCATCACCACTACCACACCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCGTGGGACACATATATGAGCTTTGCGACACTCACAGCGCTCGGTGCACAATGGTCTTTCCCTCCAGGGCAACGTTCAGTTTCTAGACGCTCGTTCAACCACCACAAAGCGAGAGGGGCCGGGGACCCCAAGGGACAGAGATGGCACACGCTTGTTCCGCTCGGCACAGAGACCATCACCGACAGCTACATGAGTGCACCGGCATCAGAGCTGGACACTAACTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAATCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAACCGGTAATGAAGAGCGATGCATGGGCGGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCATACCCATGGGACGTCAACTGGGCCAACAGCACCATGTACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q96672_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGIIFLTEGLILPKNSTAGGYADHLYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSQSQAAQNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITTTTPQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMDWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCAGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTACCGAACCCCCAGTCAACGATGACTATCCGCTTCCAAGGAATCATTTTTCTTACCGAAGGACTCATTCTACCTAAAAACAGTACAGCGGGGGGATATGCAGACCACCTGTACGGGGCGAGAGTCGCCAAGATCTCAGTGAACCTGAAAGAGTTCCTCCTAGCGTCAATGAACCTGACATACGTGAGCAAAATAGGAGGACCCATCGCCGGTGAGTTGATTGCGGACGGGTCTCAATCACAAGCCGCGCAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCTTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAATCACCCTAAACAAATGACCCTGCAAGACATGGGTCGGATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAGCAACCGATGACGGGGGGTATTGCTTATGCGACGGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCCGACCCCCCGATCATCACCACTACCACACCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCGTGGGACACATATATGAGCTTTGCAACACTCACAGCGCTCGGTGCACAATGGTCTTTCCCTCCAGGGCAACGTTCAGTTTCTAGACGCTCGTTCAACCACCACAAAGCGAGAGGGGCCGGGGACCCCAAGGGACAGAGATGGCACACGCTTGTTCCGCTCGGCACAGAGACCATCACCGACAGCTACATGAGTGCGCCGGCATCAGAGCTGGACACTAACTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAATCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAACCGGTAATGAAGAGCGATGCATGGGCGGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCATACCCATGGGACGTCAACTGGGCCAACAGCACCATGGACTGGGGGTCGCAGCCC
TRN  10010101100011000
NAM  Q96674_9CIRC/1-449
ASQ  MARRARRPRGRFYAFRRGRWHHLKRLQRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGTIFLTEGLILPKNSTAGGYADHLYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSQSQAAQNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCAGATTTTACGCCTTCAGAAGAGGACGGTGGCACCACCTCAAGCGACTTCAACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTACCGAACCCCCAGTCAACGATGACTATCCGCTTTCAAGGAACCATTTTTCTTACCGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACCTGTACGGGGCGAGAGTCGCCAAGATCTCAGTGAACCTGAAAGAGTTCCTCCTAGCGTCAATGAACCTGACATACGTGAGCAAAATAGGAGGCCCCATCGCCGGTGAGTTAATTGCGGACGGGTCTCAATCACAAGCCGCGCAGAATTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCTACACCATCGGCATGGTGGAGATGGGCTTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTTTTTAATCACCCTAAACAAATGACTCTGCAAGACATGGGTCGGATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAAACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAACCACCACAAGGCGAGAGGAGCCGGGGACCCCAAGGGACAGAGATGGCACACGCTGGTGCCGCTCGGCACGGAGACCATCACCGACAGCTACATGAGTGCACCGGCATCAGAGCTGGACACTAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAATCTCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAACCGGTAATGAAGAGCGATGCATGGGCGGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAAAGGCCATACCCATGGGATGTCAACTGGGCCAACAGCACCATGTACTGGGGGACGCAGCCC
TRN  10010101100011000
NAM  VP1_CAVCI/1-449
ASQ  MARRARRPRGRFYAFRRGRWHNLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGIIFLTEGLILPKNSTAGGYADHLYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSQSQAAQNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTLQDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWRKGEQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNFFTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGSQP
DSQ  ATGGCAAGACGAGCTCGCAGACCGAGAGGCCGATTTTACGCCTTCAGAAGAGGACGGTGGCACAACCTCAAGCGACTTCGACGAAGATATAAATTTCGACATCGGAGGAGACAGCGGTATCGTAGACGAGCTTTTAGGAAGGCCTTTCACAACCCCCGCCCCGGTACGTATAGTGTGAGGCTGCCGAACCCCCAATCTACTATGACTATCCGCTTCCAAGGAATCATATTTCTCACGGAAGGACTCATTCTGCCTAAAAACAGCACAGCGGGGGGCTATGCAGACCACTTGTACGGGGCGAGAGTCGCCAAGATCTCTGTGAACCTGAAAGAGTTCCTGCTAGCGTCAATGAACCTGACATACGTGAGCAAAATCGGAGGCCCCATCGCCGGTGAGTTGATTGCGGACGGGTCTCAATCACAAGCCGCGCAGAACTGGCCTAATTGCTGGCTGCCGCTAGATAATAACGTGCCCTCCGCGACACCATCGGCATGGTGGAGATGGGCCTTAATGATGATGCAGCCCACGGACTCTTGCCGGTTCTTTAACCACCCTAAGCAGATGACCCTGCAAGACATGGGTCGCATGTTTGGGGGCTGGCACCTGTTCCGACACATTGAGACCCGCTTTCAGCTCCTTGCCACTAAGAATGAGGGATCCTTCAGCCCCGTGGCGAGTCTTCTCTCCCAGGGAGAGTACCTCACGCGTCGGGACGATGTTAAGTACAGCAGCGATCACCAGAACCGGTGGCGAAAAGGCGAACAACCGATGACGGGGGGTATTGCTTATGCGACCGGGAAAATGAGACCCGACGAGCAACAGTACCCTGCTATGCCCCCAGACCCCCCGATCATCACCGCTACTACAGCGCAAGGCACGCAAGTCCGCTGCATGAATAGCACGCAAGCTTGGTGGTCATGGGACACATATATGAGCTTTGCAACACTCACAGCACTCGGTGCACAATGGTCTTTTCCTCCAGGGCAACGTTCAGTTTCTAGACGGTCCTTCAATCACCACAAGGCGAGAGGAGCCGGAGACCCCAAAGGGCAGAGATGGCACACGCTGGTGCCGCTAGGCACGGAGACCATCACGGACAGCTACATGAGTGCACCTGCATCAGAGCTGGACACGAATTTCTTTACGCTTTACGTAGCGCAAGGCACAAATAAGTCGCAGCAGTACAAGTTCGGCACAGCTACATACGCGCTAAAGGAGCCGGTAATGAAGAGCGATGCATGGGCAGTGGTACGCGTCCAGTCGGTCTGGCAACTGGGTAACAGGCAGAGGCCATACCCATGGGACGTCAACTGGGCCAACAGCACCATGTACTGGGGGTCGCAGCCC
TRN  10010101100011000
//