EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04157 - EAP30)
FAM  PF04157
PID  EAP30
DES  EAP30
IPR  IPR007286
ANO  3
ALN  167
AID  0.360695
APH  (Q9VD72_DROME/88-253:0.58393,Q9SZ43_ARATH/20-181:0.68604,O94663_SCHPO/89-249:0.92664);
ATP  (Q9VD72_DROME/88-253,Q9SZ43_ARATH/20-181,O94663_SCHPO/89-249);
ATL  2.19661
DNO  3
DLN  501
DID  0.448081
DPH  (Q9VD72_DROME/88-253:0.42402,Q9SZ43_ARATH/20-181:0.51749,O94663_SCHPO/89-249:0.64118);
DTP  (Q9VD72_DROME/88-253,Q9SZ43_ARATH/20-181,O94663_SCHPO/89-249);
DTL  1.58269
RID  0.360695
RPH  (Q9VD72_DROME/88-253:0.58393,Q9SZ43_ARATH/20-181:0.68604,O94663_SCHPO/89-249:0.92664);
RTP  (Q9VD72_DROME/88-253,Q9SZ43_ARATH/20-181,O94663_SCHPO/89-249);
RTL  2.19661
LNK  O94663_SCHPO/89-249:O94663:AL035570
LNK  Q9SZ43_ARATH/20-181:Q9SZ43:AL035440
LNK  Q9VD72_DROME/88-253:Q9VD72:AE003736
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VD72_DROME/88-253
ASQ  VLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAARGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGCVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWID-KQAGDEPAYWFPSLFPGRNAQTTAA
DSQ  GTTCTGGGAATGGGCGATTTCTACTACGAACTGGGCGTCCAGGTGGTGGAGGTTTGTCTAGCTGCCAATCACAAAACCGGTGGACTTATGGAGCTGGACGATCTGCGACGTCGGCTAATCGCCGCCAGAGGTCAGAGTTCAGTGCACCAGGAGATCACCAAGGAGGACATCCTAATGGCCGCTAAGAAATTGAGCATTTTTGGCAACGGCTTTGTGGTTCACAAGCTGGGCAAGGGCAAGTACATAGTTCAGTCCATTCCCGGAGAGCTGAGCATGGAGGAGACCAACATACTGAATGCCGCATCCAATACCGAACAAGGCTGTGTTACGCAGAGTCAGCTGATCAAGGATTTGGGCTGGACCGACTATCGTGCTCAACAGTCACTGGACAAGGTGCTCGGCGAAGGTCTCTGTTGGATTGAC---AAGCAGGCGGGCGATGAGCCAGCCTATTGGTTTCCCAGTTTGTTTCCCGGTCGAAACGCACAGACAACGGCCGCC
TRN  10010101100011001
NAM  Q9SZ43_ARATH/20-181
ASQ  LLGIGDFYYELGVQIIEVCMLTRSHNGGLISLQELCNHLRQRRKKD--REAVTEDDCLRAISKLKVLGSGFEVITIG-KKKLVRSVPTELNKDHNQILELAQ--GQGFVIVEEVQRRLSWTSGRVIDALETLLEEGLAMIDNGHKDGKCRYWFPCVSSVYSSIGSDT
DSQ  CTCCTTGGTATTGGTGACTTCTACTATGAACTTGGAGTTCAGATTATTGAAGTTTGCATGCTTACAAGATCACATAATGGAGGTTTGATCAGCTTGCAAGAGCTCTGCAACCATCTTCGTCAGAGAAGGAAGAAAGAC------CGTGAAGCTGTGACTGAAGATGATTGTCTTCGAGCTATTAGCAAGCTAAAGGTATTGGGTAGCGGATTTGAGGTTATCACTATTGGC---AAGAAAAAGCTTGTCCGTTCAGTACCCACAGAGCTGAACAAAGACCATAACCAGATTTTGGAGTTGGCTCAG------GGCCAAGGCTTTGTGATTGTGGAAGAGGTACAAAGACGCCTCTCATGGACATCTGGTCGCGTTATAGATGCTCTCGAAACTTTGTTAGAGGAGGGCCTTGCCATGATCGACAATGGCCATAAAGACGGAAAGTGTCGGTACTGGTTTCCCTGTGTTTCTTCGGTTTACTCATCCATCGGATCTGATACT
TRN  10010101100011000
NAM  O94663_SCHPO/89-249
ASQ  AVGMNEFYYQVAVRVIEVCYATQMENGGLLSVSQVCRFLNEENEAFG-HEWLRETDVVRAVDSLAPLGPGFVLEKIA-GKQYIRSLPLELNTDQNVVLEAVE--ILGYVTISILRDNYAWERSRCIQVLNDLVSKSLLWID--SQGVEMAYWGASNLIDDQAQRFLY
DSQ  GCCGTGGGCATGAACGAATTCTATTATCAGGTCGCTGTACGAGTAATCGAAGTCTGTTATGCTACTCAAATGGAGAATGGAGGCCTCTTATCGGTCAGCCAAGTTTGTCGTTTTTTAAATGAAGAAAATGAAGCCTTTGGT---CATGAATGGTTAAGAGAGACTGACGTTGTTCGAGCTGTCGATAGTTTGGCCCCACTTGGCCCTGGCTTTGTTCTTGAAAAAATTGCA---GGTAAACAGTATATCCGGTCCCTTCCTTTAGAGCTCAACACCGACCAAAATGTTGTTTTAGAGGCTGTAGAG------ATATTGGGCTATGTAACAATATCTATTTTACGGGACAATTACGCTTGGGAGCGTAGCAGATGCATTCAAGTATTGAATGATTTAGTTTCAAAATCATTACTCTGGATTGAC------TCCCAGGGGGTGGAGATGGCCTATTGGGGTGCAAGCAATCTTATCGACGACCAGGCGCAAAGGTTTTTATAC
TRN  10010101110011000
//