EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04131 - NanE)
FAM  PF04131
PID  NanE
DES  Putative N-acetylmannosamine-6-phosphate epimerase
IPR  IPR007260
ANO  7
ALN  201
AID  0.488643
APH  ((NANE_STRPY/38-234:0.25386,NANE_LACLA/34-230:0.18205):0.21633,(NANE_ECOLI/35-226:0.27396,((NANE_PASMU/35-226:0.09070,NANE_HAEIN/35-226:0.16772):0.16276,NANE_VIBCH/41-232:0.36656):0.06925):0.55533,NANE_BORBU/29-229:0.50664);
ATP  ((NANE_STRPY/38-234,NANE_LACLA/34-230),(NANE_ECOLI/35-226,((NANE_PASMU/35-226,NANE_HAEIN/35-226),NANE_VIBCH/41-232)),NANE_BORBU/29-229);
ATL  2.84516
DNO  6
DLN  603
DID  0.532688
DPH  ((NANE_VIBCH/41-232:0.30455,(NANE_STRPY/38-234:0.34320,NANE_BORBU/29-229:0.36437):0.31133):0.07824,NANE_ECOLI/35-226:0.34024,(NANE_HAEIN/35-226:0.18106,NANE_PASMU/35-226:0.18297):0.11957);
DTP  ((NANE_VIBCH/41-232,(NANE_STRPY/38-234,NANE_BORBU/29-229)),NANE_ECOLI/35-226,(NANE_HAEIN/35-226,NANE_PASMU/35-226));
DTL  2.22553
RID  0.49656
RPH  (NANE_STRPY/38-234:0.39415,(((NANE_PASMU/35-226:0.09112,NANE_HAEIN/35-226:0.16797):0.16948,NANE_VIBCH/41-232:0.36081):0.07408,NANE_ECOLI/35-226:0.26576):0.58124,NANE_BORBU/29-229:0.49955);
RTP  (NANE_STRPY/38-234,(((NANE_PASMU/35-226,NANE_HAEIN/35-226),NANE_VIBCH/41-232),NANE_ECOLI/35-226),NANE_BORBU/29-229);
RTL  2.60416
LNK  NANE_BORBU/29-229:O51589:AE001166
LNK  NANE_ECOLI/35-226:P45426:U18997
LNK  NANE_HAEIN/35-226:P71340:U32700
LNK  NANE_LACLA/34-230:Q9CGC2:
LNK  NANE_PASMU/35-226:Q9L6B4:AF237924
LNK  NANE_STRPY/38-234:P65522:AE006492
LNK  NANE_VIBCH/41-232:Q9KR62:AE004255
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NANE_BORBU/29-229
ASQ  MSKMALAAKIGGAIGIRANGVNDISQIKLEVDLPIIGIIKKNYNNCDVFITPTMKEIDELCNEGVDIIALDATFRNRPDGVLLDDFFENIKKKYPKQCLMADISSLDEAINADKLGFDFIGTTLYGYTKNTNGlNIADNDFNFLRTLLNSNLKSTLIVEGKIDTPLKAQKCFEMGVDLVVVGGAITRPAEITKKFVEKINQ
DSQ  ATGTCTAAGATGGCTTTGGCAGCCAAAATAGGTGGAGCTATTGGAATAAGAGCCAACGGAGTTAATGATATTAGCCAGATTAAGTTGGAAGTTGATTTGCCAATAATAGGTATTATTAAAAAAAATTATAATAATTGCGACGTATTTATTACTCCTACCATGAAAGAGATTGATGAGCTTTGTAATGAGGGGGTAGATATAATTGCCCTTGATGCCACTTTTAGAAATAGGCCTGATGGCGTGCTACTTGATGATTTTTTTGAAAATATTAAAAAAAAATATCCAAAGCAGTGTTTGATGGCAGATATTTCTTCTTTAGATGAAGCTATTAATGCCGATAAATTGGGATTTGATTTTATTGGAACAACTTTGTATGGCTATACAAAAAATACCAATGGTttgAATATTGCAGACAATGATTTTAATTTTTTAAGAACCTTGCTTAATTCTAATTTGAAATCTACTTTAATAGTGGAAGGAAAAATAGACACCCCTTTAAAAGCTCAAAAATGCTTTGAAATGGGGGTTGATTTAGTGGTTGTAGGGGGTGCTATTACAAGGCCCGCTGAGATTACTAAAAAATTTGTAGAAAAAATAAATCAG
TRN  10010101110011010
NAM  NANE_STRPY/38-234
ASQ  MPLMAKAAQEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAVIAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSGYTPYSR-.QEAGPDVALIEALCKAGIA--VIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPKEIAERFIEALKS
DSQ  ATGCCACTGATGGCAAAAGCTGCTCAAGAAGCTGGTGCTGTCGGCATCAGAGCTAATTCGGTTAGAGACATTAAAGAAATTCAAGCCATAACAGACCTACCAATTATCGGTATCATCAAAAAAGATTACCCGCCGCAAGAGCCTTTTATTACGGCAACGATGACCGAAGTGGATCAATTAGCTGCCTTAAATATTGCAGTGATTGCTATGGATTGTACCAAGCGTGACCGACATGATGGCTTGGATATTGCTAGCTTTATTCGACAAGTTAAGGAAAAGTACCCCAATCAGCTTTTGATGGCAGATATTAGTACCTTTGATGAAGGACTAGTGGCCCATCAGGCTGGCATTGATTTTGTTGGAACCACCTTGTCAGGCTACACCCCGTATAGCCGT---...CAGGAAGCAGGTCCTGATGTGGCATTGATAGAAGCTCTTTGCAAAGCAGGCATTGCT------GTCATTGCCGAAGGAAAGATTCATTCCCCAGAAGAAGCCAAGAAAATTAATGACTTAGGTGTGGCAGGTATTGTTGTTGGAGGGGCCATCACAAGGCCTAAGGAAATTGCAGAGCGTTTTATCGAAGCGCTCAAATCC
TRN  10010101100011000
NAM  NANE_LACLA/34-230
ASQ  MPLMAKAAAQAGAVGIRANSVRDIKEIQKIVDLPIIGIIKRDYPPQKPFITATMKEIDELVATSCEVIALDCTSRERYDGLTINEFIKSIKEKYPNQLLMADCSTFEECKNAYEAGVDFVGTTLSGYTDESP-.KQDEPDFTLLEKLVEEKIP--VIAEGRIHSPEQAKRVYDIGVDAMVIGGAITRPFEIATRFIKAIGE
NAM  NANE_PASMU/35-226
ASQ  VAAMAQASVIGGAAGLRIEGIENLKATRNVVNVPIIGIVKRDLPDSPVRISPFLQDIEELAAAGADIIAFDGTDRVRP--TTREAIIKRIKELG--CLAMADCSNFEEGMYCHNLGVEIIGSTMSGYTGGEIP.--AEPDYQLVKDLNAAGCR--VMAEGRYNTPELAKTAIEIGAYSVTVGSALTRLEHIVSWFADAVKS
DSQ  GTTGCCGCCATGGCGCAAGCATCCGTTATCGGTGGTGCTGCCGGGTTACGTATTGAAGGGATCGAAAATTTAAAAGCCACGCGTAACGTCGTCAATGTACCGATTATTGGTATCGTTAAACGCGATTTACCTGACAGTCCCGTTCGTATTAGCCCATTTTTACAAGACATTGAAGAGTTAGCCGCAGCAGGCGCCGATATTATTGCTTTTGATGGTACCGATCGCGTCCGTCCA------ACTACACGTGAAGCCATTATTAAACGAATCAAAGAATTAGGT------TGTTTAGCCATGGCGGATTGTTCTAATTTTGAAGAAGGGATGTATTGCCACAACTTAGGGGTAGAAATTATTGGTAGCACCATGTCTGGTTATACTGGCGGTGAAATTCCA...------GCTGAACCGGATTATCAGTTAGTCAAAGATTTGAATGCTGCTGGCTGCCGA------GTGATGGCAGAAGGGCGCTATAACACCCCAGAATTGGCGAAAACCGCAATTGAGATTGGTGCTTACTCTGTCACCGTAGGATCTGCGCTGACTCGCCTCGAACATATCGTAAGCTGGTTTGCCGATGCCGTCAAATCG
TRN  11011101101011010
NAM  NANE_HAEIN/35-226
ASQ  VSAMAQASVMGGRSGLRIEGVDNLKATRPFVNVPIIGIVKRDLPDSPVRITPFLQDIEDLANAGADIIAVDGTSRPRP--VDIESAVKKIHEMG--CLAMADCSNLEEGLYCKALGFDIVGSTMSGYTGGAVP.--EEPDYQLVKDLKSAGCF--VMAEGRYNTPELAKVAIEIGADCVTVGSALTRLEHIVSWFANSVKS
DSQ  GTTTCTGCTATGGCTCAGGCTTCAGTTATGGGCGGACGTTCTGGCTTACGTATTGAGGGTGTTGATAACCTTAAAGCAACCCGTCCTTTTGTGAATGTCCCGATTATCGGAATTGTAAAACGTGATTTGCCTGATAGTCCCGTGCGTATTACGCCGTTTTTACAAGATATTGAAGATCTAGCCAATGCTGGCGCGGATATTATTGCAGTAGATGGCACGAGCCGTCCACGTCCT------GTGGATATTGAAAGTGCGGTGAAAAAAATCCACGAAATGGGC------TGTTTGGCAATGGCAGATTGTTCTAATTTAGAAGAAGGCTTGTATTGTAAAGCGCTTGGTTTTGATATTGTCGGCAGTACGATGTCAGGTTATACAGGTGGCGCAGTGCCA...------GAAGAACCAGATTATCAATTAGTGAAAGATTTAAAATCAGCGGGTTGTTTT------GTGATGGCTGAGGGGCGTTATAACACACCAGAATTGGCAAAAGTGGCAATTGAAATTGGTGCAGATTGCGTGACTGTAGGTTCAGCCTTAACTCGTCTTGAACATATTGTGAGTTGGTTTGCTAATTCAGTGAAATCT
TRN  11011101111011000
NAM  NANE_ECOLI/35-226
ASQ  VAAMALAAEQAGAVAIRIEGVANLQATRAVVSVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDRPRP--VPVETLLARIHHHG--LLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETP.--EEPDLALVKTLSDAGCR--VIAEGRYNTPAQAADAMRHGAWAVTVGSAITRLEHICQWYNTAMKK
DSQ  GTCGCCGCCATGGCATTAGCGGCAGAACAGGCGGGCGCGGTTGCCATTCGCATTGAAGGTGTGGCAAATCTGCAAGCCACGCGTGCGGTGGTGAGCGTGCCGATTATTGGAATTGTGAAACGCGATCTGGAGGATTCTCCGGTACGCATCACGGCCTATATTGAAGATGTTGATGCGCTGGCGCAGGCGGGCGCGGACATTATCGCCATTGACGGCACCGACCGCCCGCGTCCG------GTGCCTGTTGAAACGCTGCTGGCACGTATTCACCATCACGGT------TTACTGGCGATGACCGACTGCTCAACGCCGGAAGACGGCCTGGCATGCCAAAAGCTGGGAGCCGAAATTATTGGCACTACGCTTTCTGGCTATACCACGCCTGAAACGCCA...------GAAGAGCCGGATCTGGCGCTGGTGAAAACGTTGAGCGACGCCGGATGTCGG------GTGATTGCCGAAGGGCGTTACAACACGCCTGCTCAGGCGGCGGATGCGATGCGCCACGGCGCGTGGGCGGTGACGGTCGGTTCTGCAATCACGCGTCTTGAGCACATTTGTCAGTGGTACAACACAGCGATGAAAAAG
TRN  11011101101011000
NAM  NANE_VIBCH/41-232
ASQ  IVAMAIAVEQAGAKALRIEGVNNVAAVSAAVTIPIIGIVKRDLPDSPIRITPFVSDVDGLANAGATVIAFDATDRTRP--ESRERIAQAIKNTG--CFAMADCSTFEDGLWANSQGVEIVGSTLSGYVGDIEP.--TVPDFQLVKAFSEAGFF--TMAEGRYNTPELAAKAIESGAVAVTVGSALTRLEVVTQWFNNATQA
DSQ  ATTGTGGCGATGGCGATCGCCGTCGAACAAGCGGGTGCAAAAGCGCTGCGCATTGAAGGTGTGAATAACGTGGCTGCTGTATCCGCCGCAGTAACAATTCCGATTATAGGTATCGTTAAGCGTGACTTGCCTGATAGCCCAATTCGAATCACTCCTTTTGTTTCAGATGTTGATGGCTTAGCAAATGCTGGCGCAACGGTCATTGCTTTTGATGCCACCGATAGAACACGCCCT------GAAAGTCGAGAACGTATTGCGCAAGCAATCAAAAACACGGGA------TGTTTTGCGATGGCCGATTGCTCCACATTCGAGGATGGATTATGGGCTAACTCACAAGGTGTTGAAATTGTTGGATCAACACTGTCAGGCTATGTCGGAGATATTGAGCCC...------ACGGTTCCAGATTTCCAACTTGTGAAAGCGTTTTCTGAAGCCGGCTTTTTT------ACCATGGCGGAAGGTCGATACAATACGCCTGAGTTAGCAGCGAAAGCTATTGAGTCTGGTGCGGTTGCCGTAACGGTTGGTTCTGCATTGACTCGATTAGAAGTGGTTACTCAATGGTTCAATAACGCAACCCAAGCT
TRN  10010101100011000
//