EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04102 - SlyX)
FAM  PF04102
PID  SlyX
DES  SlyX
IPR  IPR007236
ANO  8
ALN  69
AID  0.363289
APH  ((((SLYX_VIBCH/5-72:0.30616,SLYX_XYLFA/12-78:1.23351):0.19411,SLYX_ECOLI/5-72:0.42007):0.08775,(SLYX_PSEAE/2-69:0.65161,(SLYX_RHILO/1-67:1.09387,SLYX_NEIMB/6-74:0.94434):0.14307):0.18660):0.17484,SLYX_PASMU/6-73:0.11129,SLYX_HAEIN/6-73:0.20232);
ATP  ((((SLYX_VIBCH/5-72,SLYX_XYLFA/12-78),SLYX_ECOLI/5-72),(SLYX_PSEAE/2-69,(SLYX_RHILO/1-67,SLYX_NEIMB/6-74))),SLYX_PASMU/6-73,SLYX_HAEIN/6-73);
ATL  5.88347
DNO  8
DLN  207
DID  0.481376
DPH  (SLYX_XYLFA/12-78:0.62421,((SLYX_PASMU/6-73:0.17219,SLYX_HAEIN/6-73:0.16857):0.17709,SLYX_VIBCH/5-72:0.38243):0.07153,((SLYX_NEIMB/6-74:0.51302,(SLYX_PSEAE/2-69:0.27833,SLYX_RHILO/1-67:0.59722):0.11183):0.11851,SLYX_ECOLI/5-72:0.20684):0.11100);
DTP  (SLYX_XYLFA/12-78,((SLYX_PASMU/6-73,SLYX_HAEIN/6-73),SLYX_VIBCH/5-72),((SLYX_NEIMB/6-74,(SLYX_PSEAE/2-69,SLYX_RHILO/1-67)),SLYX_ECOLI/5-72));
DTL  3.53277
RID  0.363289
RPH  ((((SLYX_VIBCH/5-72:0.30616,SLYX_XYLFA/12-78:1.23351):0.19411,SLYX_ECOLI/5-72:0.42007):0.08775,(SLYX_PSEAE/2-69:0.65161,(SLYX_RHILO/1-67:1.09387,SLYX_NEIMB/6-74:0.94434):0.14307):0.18660):0.17484,SLYX_PASMU/6-73:0.11129,SLYX_HAEIN/6-73:0.20232);
RTP  ((((SLYX_VIBCH/5-72,SLYX_XYLFA/12-78),SLYX_ECOLI/5-72),(SLYX_PSEAE/2-69,(SLYX_RHILO/1-67,SLYX_NEIMB/6-74))),SLYX_PASMU/6-73,SLYX_HAEIN/6-73);
RTL  5.88347
LNK  SLYX_ECOLI/5-72:P30857:L13261
LNK  SLYX_HAEIN/6-73:P44759:U32739
LNK  SLYX_NEIMB/6-74:Q9JXG3:AE002556
LNK  SLYX_PASMU/6-73:Q9CL92:AE006173
LNK  SLYX_PSEAE/2-69:Q9I4Z9:AE004530
LNK  SLYX_RHILO/1-67:Q98GW1:AP003001
LNK  SLYX_VIBCH/5-72:Q9KV06:AE004123
LNK  SLYX_XYLFA/12-78:Q9PCZ7:AE003988
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SLYX_XYLFA/12-78
ASQ  AFEARLIELETRVSFQEQALTEISEALAETRLIGARNAELMRHLLEELGKVRN--TLYEHPIDEPPPHY
DSQ  GCGTTTGAAGCCCGCCTAATTGAACTGGAGACGCGTGTTTCTTTCCAAGAACAAGCGTTGACTGAAATAAGCGAAGCCTTGGCAGAAACTCGGTTGATCGGGGCACGTAATGCTGAGTTGATGCGTCATTTGCTTGAGGAGTTGGGCAAGGTACGCAAT------ACACTGTATGAGCATCCGATCGACGAACCACCGCCGCACTAT
TRN  10010111100111011
NAM  SLYX_RHILO/1-67
ASQ  MPADRLTTLEIRAAEQERTIEELSGQIAEQWTVIERMQRKLDALTDRFLALEE--QAAPDVPVTKPPHW
DSQ  ATGCCCGCCGACCGGCTGACGACGCTCGAAATCCGCGCCGCCGAGCAGGAAAGGACCATCGAGGAACTGTCGGGACAGATCGCCGAGCAGTGGACGGTGATCGAGCGCATGCAGCGCAAGCTCGACGCGCTGACCGATCGCTTCCTGGCGCTGGAGGAG------CAGGCGGCGCCCGACGTGCCGGTGACCAAGCCGCCGCATTGG
TRN  10010101100011011
NAM  SLYX_PSEAE/2-69
ASQ  ELDARMDDLECRQAFQDDTLQALNDVVVEQQRSIERLQLQVAALIKRLEDVQGLVGEAGE-DEAPPPHY
DSQ  GAGCTGGACGCGCGCATGGATGACCTGGAATGCCGCCAGGCTTTCCAGGATGACACTTTGCAGGCTCTCAACGATGTGGTGGTCGAGCAGCAGCGCAGCATCGAGCGACTGCAGCTTCAGGTCGCGGCATTGATCAAGCGTCTGGAAGACGTCCAGGGGCTGGTGGGCGAGGCGGGGGAA---GACGAAGCGCCTCCTCCCCATTAT
TRN  11011111101111111
NAM  SLYX_VIBCH/5-72
ASQ  QLQERIEDLECKLAFQEQTIETLNDALTQQQLLLSKMQDQMKYVVGKVKNMDT-STLADPAHETPPPHY
DSQ  CAACTTCAAGAGCGCATTGAAGATTTAGAGTGCAAATTAGCTTTTCAAGAGCAAACCATCGAAACTCTTAATGATGCATTAACCCAGCAGCAACTGCTGCTCAGTAAGATGCAAGATCAGATGAAATACGTGGTCGGTAAAGTCAAAAATATGGACACT---TCCACTCTAGCGGATCCTGCGCACGAAACGCCGCCTCCACACTAC
TRN  11011101101011010
NAM  SLYX_ECOLI/5-72
ASQ  SLEARLAELESRLAFQEITIEELNVTVTAHEMEMAKLRDHLRLLTEKLKASQP-SNIASQAEETPPPHY
DSQ  TCATTGGAAGCACGCCTGGCAGAGCTGGAGAGCCGACTGGCTTTTCAGGAAATCACCATTGAAGAACTGAACGTCACGGTGACCGCTCATGAAATGGAGATGGCGAAACTGCGCGATCATCTGCGTCTGCTGACCGAGAAGTTAAAAGCCAGCCAGCCG---TCGAACATCGCGTCGCAGGCTGAAGAAACGCCACCGCCACATTAT
TRN  11011101101011000
NAM  SLYX_HAEIN/6-73
ASQ  MLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQLRYMANKLKDFQS-SNIASQSEETPPPHY
DSQ  ATGTTAGAAAATCGCATCGAAGAACTTGAAATGAAAATTGCATTTCAGGAACAGTTATTAGATGAATTAAATCACGCTTTAGTTCAACAGCAATTTGATATTGATAAAATGCAAGTCCAATTGCGTTATATGGCAAATAAATTAAAAGACTTTCAATCG---TCTAACATTGCAAGTCAATCTGAAGAAACGCCACCGCCCCATTAT
TRN  11011101111011010
NAM  SLYX_PASMU/6-73
ASQ  TLEQRIAELEMKTTFQEKLLDELNQVIVEQQFAIDKIHVQLRYLVNKFKDMQP-SNIASQAEETPPPHY
DSQ  ACCCTCGAACAGCGAATTGCTGAGTTAGAAATGAAAACTACTTTTCAAGAAAAACTCTTAGATGAGTTAAACCAAGTGATTGTTGAACAACAATTTGCCATAGACAAAATCCATGTACAATTGCGTTATTTAGTTAATAAATTCAAAGATATGCAACCT---TCCAACATTGCGAGCCAAGCCGAAGAAACTCCACCACCACATTAT
TRN  10010101110011010
NAM  SLYX_NEIMB/6-74
ASQ  ELERRIVELEIQSALQEDVIAGLNAMVAELRQTLDLQQAQLRLLYQKMQDRNPDAQEPYSLRDEIPPHY
DSQ  GAGTTGGAACGCCGTATTGTCGAACTGGAAATCCAATCCGCGCTTCAGGAGGACGTAATCGCCGGCCTGAACGCGATGGTGGCGGAATTGCGGCAGACGCTGGATTTGCAGCAGGCTCAGTTGAGGCTGCTGTATCAAAAAATGCAGGACAGGAATCCCGACGCGCAAGAGCCGTATTCCCTGCGCGACGAGATTCCGCCGCATTAT
TRN  10010101100011011
//