EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04096 - Nucleoporin2)
FAM  PF04096
PID  Nucleoporin2
DES  Nucleoporin autopeptidase
IPR  IPR007230
ANO  3
ALN  188
AID  0.376671
APH  (NU145_YEAST/442-624:0.64646,NU189_SCHPO/777-953:0.57125,NUP98_HUMAN/727-899:0.80733);
ATP  (NU145_YEAST/442-624,NU189_SCHPO/777-953,NUP98_HUMAN/727-899);
ATL  2.02504
DNO  3
DLN  564
DID  0.471751
DPH  (NU145_YEAST/442-624:0.52583,NU189_SCHPO/777-953:0.41029,NUP98_HUMAN/727-899:0.49156);
DTP  (NU145_YEAST/442-624,NU189_SCHPO/777-953,NUP98_HUMAN/727-899);
DTL  1.42768
RID  0.376671
RPH  (NU145_YEAST/442-624:0.64646,NU189_SCHPO/777-953:0.57125,NUP98_HUMAN/727-899:0.80733);
RTP  (NU145_YEAST/442-624,NU189_SCHPO/777-953,NUP98_HUMAN/727-899);
RTL  2.02504
LNK  NU145_YEAST/442-624:P49687:X76557
LNK  NU189_SCHPO/777-953:Q9UTK4:AL133357
LNK  NUP98_HUMAN/727-899:P52948:U41815
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NU145_YEAST/442-624
ASQ  LNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQ---LAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVDKKTKKPMKDTTKFAEFQVFDR--KLRSMREMNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEIDEDDLS
DSQ  TTGAATAAACAAGACGGCGAAAATACTTTACAACATGAAAAGTCATCAAGTTTTGGTTATTGGTGTTCTCCTTCCCCAGAACAGCTGGAGCGTTTGTCATTGAAGCAA---------TTAGCGGCCGTTTCAAATTTTGTTATCGGGAGAAGAGGTTATGGTTGTATTACATTTCAACATGATGTGGATCTCACAGCTTTTACCAAAAGCTTTAGAGAAGAACTATTCGGTAAAATTGTAATATTTCGTTCCTCTAAGACAGTAGAAGTATATCCTGACGAAGCCACCAAACCAATGATTGGGCATGGGTTAAACGTTCCCGCTATAATCACTCTAGAGAATGTTTATCCTGTAGATAAAAAAACAAAAAAACCGATGAAAGATACGACGAAGTTTGCTGAATTTCAAGTTTTTGACAGG------AAACTAAGAAGCATGAGGGAAATGAACTATATATCCTATAATCCCTTTGGCGGGACTTGGACTTTCAAAGTCAATCATTTTAGCATTTGGGGGTTAGTCAATGAAGAAGATGCGGAAATAGATGAAGACGATTTGAGT
TRN  10010101100011000
NAM  NU189_SCHPO/777-953
ASQ  QNEADGSLKKDEHVVLSDDYWMKPSIEELSKYPKEK---LCSVHQFSVGRTGYGQVAFLKPVDLSGFE--KLEDIPGKVVVF-ERKICAVYPVEGSSPPLGEGLNVPAIITLEKTWPLSRETREPIKDPQNPR---YIQHVKRLHRIKDTEFIDFN--DGKWIFKVQHFSRYGLLDDEEEENDMSSTS
DSQ  CAAAATGAAGCAGATGGCTCTTTAAAGAAAGACGAACATGTAGTTCTATCTGACGATTACTGGATGAAACCCTCAATTGAGGAGCTTTCTAAGTATCCTAAAGAAAAA---------TTATGTTCTGTCCATCAATTCTCTGTCGGTCGCACTGGCTATGGCCAAGTTGCATTTTTAAAACCCGTCGATTTGAGTGGATTCGAA------AAGCTTGAAGACATACCTGGCAAGGTCGTTGTTTTT---GAGAGAAAGATTTGCGCCGTATATCCTGTTGAGGGATCAAGTCCTCCTTTGGGTGAAGGCCTTAATGTTCCTGCCATAATTACACTTGAAAAAACCTGGCCATTATCTCGAGAGACTCGAGAGCCTATTAAGGATCCTCAGAACCCTAGA---------TACATTCAACATGTAAAGAGACTTCATCGTATTAAAGATACCGAATTTATTGACTTTAAT------GACGGAAAATGGATCTTCAAGGTTCAGCATTTCTCTAGATACGGTTTGCTGGATGATGAAGAGGAAGAAAACGATATGTCATCAACTAGT
TRN  10010101100011000
NAM  NUP98_HUMAN/727-899
ASQ  YHMHPAGII-----LTKVGYYTIPSMDDLAKITNE-KGE-CIVSDFTIGRKGYGSIYFEGDVNLTNLN---LDD----IVHI-RRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKT
DSQ  TACCATATGCACCCAGCAGGTATTATT---------------CTCACTAAGGTTGGTTACTATACTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAA---AAAGGAGAG---TGCATTGTCTCTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATTTGACAAATCTAAAT---------TTGGATGAT------------ATTGTGCATATC---CGGAGGAAAGAAGTAGTTGTCTACTTAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACATTGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCCTTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAATTCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGTATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACT
TRN  10010101110011000
//