EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04089 - BRICHOS)
FAM  PF04089
PID  BRICHOS
DES  BRICHOS domain
IPR  IPR007084
ANO  16
ALN  109
AID  0.24375
APH  (((((((LECT1_BRARE/75-157:0.68537,TNMD_RAT/93-186:0.83782):0.04296,(LECT1_CHICK/103-200:0.13210,LECT1_HUMAN/104-201:0.18348):0.04429):0.94740,((PSPC_HUMAN/94-197:0.13856,PSPC_RABIT/94-188:0.25067):0.14307,PSPC_RAT/95-194:0.04798):0.79342):0.31453,((Q17302_CAEBR/170-270:0.83023,Q9VPT9_DROME/172-267:0.64519):0.54321,(ITMA_HUMAN/133-227:0.42293,(ITMC_HUMAN/136-230:0.29871,ITMB_CHICK/132-226:0.16464):0.24562):0.17044):0.95709):0.46183,Q9CQS6_MOUSE/54-151:0.68006):0.39003,Q9D0T7_MOUSE/63-155:0.60430):0.58368,GKN1_HUMAN/54-150:0.22611,GKN1_MOUSE/54-148:0.13927);
ATP  (((((((LECT1_BRARE/75-157,TNMD_RAT/93-186),(LECT1_CHICK/103-200,LECT1_HUMAN/104-201)),((PSPC_HUMAN/94-197,PSPC_RABIT/94-188),PSPC_RAT/95-194)),((Q17302_CAEBR/170-270,Q9VPT9_DROME/172-267),(ITMA_HUMAN/133-227,(ITMC_HUMAN/136-230,ITMB_CHICK/132-226)))),Q9CQS6_MOUSE/54-151),Q9D0T7_MOUSE/63-155),GKN1_HUMAN/54-150,GKN1_MOUSE/54-148);
ATL  11.9671
DNO  16
DLN  327
DID  0.396899
DPH  (((((((ITMA_HUMAN/133-227:0.49692,ITMB_CHICK/132-226:0.18600):0.10529,ITMC_HUMAN/136-230:0.16082):0.20769,(Q9VPT9_DROME/172-267:0.55573,Q17302_CAEBR/170-270:0.63649):0.16933):0.21955,(Q9CQS6_MOUSE/54-151:0.42746,((GKN1_HUMAN/54-150:0.17975,GKN1_MOUSE/54-148:0.11811):0.34216,Q9D0T7_MOUSE/63-155:0.47965):0.23546):0.31008):0.18388,((LECT1_BRARE/75-157:0.31139,TNMD_RAT/93-186:0.45467):0.11439,(LECT1_CHICK/103-200:0.13751,LECT1_HUMAN/104-201:0.17158):0.08798):0.54717):0.50563,PSPC_RAT/95-194:0.12127):0.09334,PSPC_HUMAN/94-197:0.09138,PSPC_RABIT/94-188:0.12766);
DTP  (((((((ITMA_HUMAN/133-227,ITMB_CHICK/132-226),ITMC_HUMAN/136-230),(Q9VPT9_DROME/172-267,Q17302_CAEBR/170-270)),(Q9CQS6_MOUSE/54-151,((GKN1_HUMAN/54-150,GKN1_MOUSE/54-148),Q9D0T7_MOUSE/63-155))),((LECT1_BRARE/75-157,TNMD_RAT/93-186),(LECT1_CHICK/103-200,LECT1_HUMAN/104-201))),PSPC_RAT/95-194),PSPC_HUMAN/94-197,PSPC_RABIT/94-188);
DTL  7.77835
RID  0.24375
RPH  (((((((LECT1_BRARE/75-157:0.68537,TNMD_RAT/93-186:0.83782):0.04296,(LECT1_CHICK/103-200:0.13210,LECT1_HUMAN/104-201:0.18348):0.04429):0.94740,((PSPC_HUMAN/94-197:0.13856,PSPC_RABIT/94-188:0.25067):0.14307,PSPC_RAT/95-194:0.04798):0.79342):0.31453,((Q17302_CAEBR/170-270:0.83023,Q9VPT9_DROME/172-267:0.64519):0.54321,(ITMA_HUMAN/133-227:0.42293,(ITMC_HUMAN/136-230:0.29871,ITMB_CHICK/132-226:0.16464):0.24562):0.17044):0.95709):0.46183,Q9CQS6_MOUSE/54-151:0.68006):0.39003,Q9D0T7_MOUSE/63-155:0.60430):0.58368,GKN1_HUMAN/54-150:0.22611,GKN1_MOUSE/54-148:0.13927);
RTP  (((((((LECT1_BRARE/75-157,TNMD_RAT/93-186),(LECT1_CHICK/103-200,LECT1_HUMAN/104-201)),((PSPC_HUMAN/94-197,PSPC_RABIT/94-188),PSPC_RAT/95-194)),((Q17302_CAEBR/170-270,Q9VPT9_DROME/172-267),(ITMA_HUMAN/133-227,(ITMC_HUMAN/136-230,ITMB_CHICK/132-226)))),Q9CQS6_MOUSE/54-151),Q9D0T7_MOUSE/63-155),GKN1_HUMAN/54-150,GKN1_MOUSE/54-148);
RTL  11.9671
LNK  GKN1_HUMAN/54-150:Q9NS71:AY139182
LNK  GKN1_MOUSE/54-148:Q9CR36:AY139183
LNK  ITMA_HUMAN/133-227:O43736:AF038953
LNK  ITMB_CHICK/132-226:O42204:AF017985
LNK  ITMC_HUMAN/136-230:Q9NQX7:AF272043
LNK  LECT1_BRARE/75-157:P58239:AF322374
LNK  LECT1_CHICK/103-200:Q9PUU8:AF138280
LNK  LECT1_HUMAN/104-201:O75829:AB006000
LNK  PSPC_HUMAN/94-197:P11686:J03517
LNK  PSPC_RABIT/94-188:P22398:AF037445
LNK  PSPC_RAT/95-194:P11685:X14221
LNK  Q17302_CAEBR/170-270:Q17302:U56248
LNK  Q9CQS6_MOUSE/54-151:Q9CQS6:AK008986
LNK  Q9D0T7_MOUSE/63-155:Q9D0T7:AK004474
LNK  Q9VPT9_DROME/172-267:Q9VPT9:AE003588
LNK  TNMD_RAT/93-186:Q9ESC2:AF191769
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TNMD_RAT/93-186
ASQ  GNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIK-VIPEFSEPEEEIDENEEITTTFFEQ------------SVIWVPAEKPIENRD--FLKNSKILEICDNVTMYWI
DSQ  GGAAATGGCACCGATGAAACATTGGAAGTCCATGACTTTAAAAACGGATACACTGGCATCTACTTTGTAGGTCTTCAAAAATGCTTTATTAAAACTCAAATCAAA---GTGATTCCTGAATTTTCTGAACCAGAAGAGGAAATAGATGAGAATGAAGAAATTACTACAACGTTCTTTGAACAG------------------------------------TCAGTGATTTGGGTTCCTGCAGAAAAGCCTATTGAAAACAGAGAC------TTCCTGAAAAATTCTAAAATTCTGGAGATTTGCGACAATGTGACTATGTACTGGATC
TRN  10010101100011001
NAM  LECT1_HUMAN/104-201
ASQ  GSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKL-----EGKIMPVKY---EENSLIWVAVDQPVK--DNSFL-SSKVLELCGDLPIFWL
DSQ  GGAAGTGGAGCTGAAGAAGCAATTGCAGTTAATGATTTCCAGAATGGCATCACAGGAATTCGTTTTGCTGGAGGAGAGAAGTGCTACATTAAAGCGCAAGTGAAGGCTCGTATTCCTGAGGTGGGCGCCGTGACCAAACAGAGCATCTCCTCCAAACTG---------------GAAGGCAAGATCATGCCAGTCAAATAT---------GAAGAAAATTCTCTTATCTGGGTGGCTGTAGATCAGCCTGTGAAG------GACAACAGCTTCTTG---AGTTCTAAGGTGTTAGAACTCTGCGGTGACCTTCCTATTTTCTGGCTT
TRN  11011101101011010
NAM  LECT1_CHICK/103-200
ASQ  GSGSEEAVEVHDFQIGITGIRFAGGEKCYIKAQPKARVPEVDAMTKASLSSDLEDEIMPVRF--------DENSLIWVAADEPIK--HNGFL-SPKILELCGDLPIFWL
DSQ  GGAAGCGGGAGTGAAGAGGCTGTTGAAGTTCATGATTTCCAGATTGGCATCACCGGCATCCGATTTGCTGGAGGAGAGAAGTGTTACATCAAGGCCCAGCCCAAAGCTCGTGTGCCTGAGGTGGATGCCATGACCAAGGCCAGCCTGTCCTCTGACCTGGAAGATGAAATCATGCCTGTTAGATTT------------------------GACGAAAACTCTCTTATCTGGGTGGCTGCAGACGAGCCCATCAAG------CACAACGGTTTCCTA---AGCCCCAAAATTTTAGAGCTTTGTGGGGATCTTCCGATTTTCTGGCTT
TRN  10010101100011010
NAM  LECT1_BRARE/75-157
ASQ  DSAEGTIVEVQDFKAGITAVKFPGKEKCFIKSQARTELSEDEAGVKA-----------------------EVASLVWITSEEPLK--DSSFL-SPEILRFCADLPIYWH
DSQ  GATTCTGCAGAGGGGACGATCGTGGAAGTTCAAGACTTTAAAGCTGGCATCACCGCCGTCAAGTTTCCCGGAAAAGAGAAATGCTTCATCAAATCACAAGCTAGAACTGAACTTTCTGAGGATGAAGCCGGAGTGAAAGCT---------------------------------------------------------------------GAGGTGGCGTCTTTGGTCTGGATCACTTCAGAAGAGCCACTGAAG------GACAGCAGCTTCCTG---AGCCCCGAAATACTGCGATTCTGTGCAGATCTGCCCATTTACTGGCAC
TRN  10010101100011001
NAM  PSPC_RABIT/94-188
ASQ  FPIGSTGIVTCDYQRLLIAYKPAPGTCCYLMKMAPDSIPSLEALARKFQ---------ANPAEPPTQRGQ----DKGPAAGPASSGGELAFL-GAAVSTLCGEVPLIYI
DSQ  TTCCCCATCGGCTCCACCGGCATTGTCACCTGCGACTACCAGCGGCTCCTGATCGCCTATAAGCCAGCCCCGGGAACCTGCTGCTACCTCATGAAGATGGCTCCAGACAGCATCCCCAGTCTGGAGGCTCTGGCTAGAAAATTCCAG---------------------------GCCAACCCTGCAGAGCCTCCCACTCAGCGGGGCCAG------------GACAAGGGGCCAGCCGCAGGCCCGGCGTCCTCCGGAGGAGAGCTGGCCTTCCTG---GGCGCGGCCGTGAGCACCCTGTGTGGGGAGGTGCCTCTCATCTACATC
TRN  10010101100011011
NAM  PSPC_RAT/95-194
ASQ  FSIGSTGIVLYDYQRLLTAYKPAPGTYCYIMKMAPESIPSLEALARKFKN------FQAKSSTPTSKLGQEEGHSAGSDSDSSGR--DLAFL-GLAVSTLCGELPLYYI
DSQ  TTCTCTATTGGCTCCACTGGCATCGTTCTATATGACTACCAGCGGCTCCTGACCGCCTATAAGCCAGCTCCAGGAACCTACTGCTACATCATGAAGATGGCTCCAGAGAGCATCCCTAGTCTTGAGGCTTTGGCTAGAAAATTCAAGAAC------------------TTCCAGGCCAAGTCCTCCACACCCACCTCTAAGTTGGGCCAGGAAGAAGGGCACAGTGCTGGATCCGATTCTGATTCTTCTGGGCGA------GACCTGGCTTTCCTG---GGCCTTGCTGTGAGCACCTTGTGTGGAGAGCTACCACTGTACTATATC
TRN  10010101100011011
NAM  PSPC_HUMAN/94-197
ASQ  FSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQ----AEGRDAGSAPSGGDPAFL-GMAVNTLCGEVPLYYI
DSQ  TTCTCCATCGGCTCCACTGGCCTCGTGGTGTATGACTACCAGCAGCTGCTGATCGCCTACAAGCCAGCCCCTGGCACCTGCTGCTACATCATGAAGATAGCTCCAGAGAGCATCCCCAGTCTTGAGGCTCTCAATAGAAAAGTCCACAACTTCCAGATGGAATGCTCTCTGCAGGCCAAGCCCGCAGTGCCTACGTCTAAGCTGGGCCAG------------GCAGAGGGGCGAGATGCAGGCTCAGCACCCTCCGGAGGGGACCCGGCCTTCTTG---GGCATGGCCGTGAACACCCTGTGTGGCGAGGTGCCGCTCTACTACATC
TRN  10010101100011001
NAM  ITMB_CHICK/132-226
ASQ  FADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAG------TYLPQSYLIH-----EQMIVTDRIE--NVDQL-GFFIYRLCRGKETYKL
DSQ  TTTGCTGATAGCGATCCTGCTGACATCGTCCACGATTTCCATCGGAGACTGACTGCCTATCTTGACCTGAGCCTGGATAAGTGCTACGTAATCCCTCTGAACACCTCAGTTGTGATGCCACCGAAAAACTTCTTGGAGCTGCTCATCAACATCAAGGCTGGA------------------ACATATTTGCCTCAGTCCTATTTGATTCAC---------------GAGCAGATGATTGTTACCGATCGCATTGAA------AATGTGGATCAGTTG---GGATTCTTTATTTACCGCCTCTGCCGTGGCAAGGAAACCTACAAGCTG
TRN  10010101100011001
NAM  ITMC_HUMAN/136-230
ASQ  FGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRG------TYLPQTYIIQ-----EEMVVTEHVS--DKEAL-GSFIYHLCNGKDTYRL
DSQ  TTTGGCGGCGGTGACCCTGCAGACATCATCCATGACTTCCAGCGGGGTCTGACTGCGTACCATGATATCTCCCTGGACAAGTGCTATGTCATCGAACTCAACACCACCATTGTGCTGCCCCCTCGCAACTTCTGGGAGCTCCTCATGAACGTGAAGAGGGGG------------------ACCTACCTGCCGCAGACGTACATCATCCAG---------------GAGGAGATGGTGGTCACGGAGCATGTCAGT------GACAAGGAGGCCCTG---GGGTCCTTCATCTACCACCTGTGCAACGGGAAAGACACCTACCGGCTC
TRN  10010101100011011
NAM  ITMA_HUMAN/133-227
ASQ  FSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLV-----------AVEEIR--DVSNL-GIFIYQLCNNRKSFRL
DSQ  TTCTCTGATAGTGACCCTGCAGCAATTATTCATGACTTTGAAAAGGGAATGACTGCTTACCTGGACTTGTTGCTGGGGAACTGCTATCTGATGCCCCTCAATACTTCTATTGTTATGCCTCCAAAAAATCTGGTAGAGCTCTTTGGCAAACTGGCGAGTGGCAGATATCTGCCTCAAACTTATGTGGTTCGAGAAGACCTAGTT---------------------------------GCTGTGGAGGAAATTCGT------GATGTTAGTAACCTT---GGCATCTTTATTTACCAACTTTGCAATAACAGAAAGTCCTTCCGCCTT
TRN  10010101100011011
NAM  Q9VPT9_DROME/172-267
ASQ  FKDGRRGRFMHDFKENQSAIIDTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDTERVRRQMRV----------VMPRIT--DVSLI-SERIANECFDMKVYMM
DSQ  TTCAAGGATGGACGTCGTGGTCGCTTCATGCACGACTTCAAGGAGAACCAGTCGGCCATTATCGACACTACCACCGGACGGTGCTTCATCATGCCCTTGGATCGGGACACGACCCTGCCCCCGACCAGCTTTGTGGATCTCATAAAGAAGATGAGCACTGGCTACTACAACATAGATACGGAGCGCGTGCGGCGCCAGATGCGTGTG------------------------------GTCATGCCCCGCATCACC------GATGTCTCGCTCATC---TCGGAGCGGATTGCCAACGAGTGCTTCGATATGAAGGTCTACATGATG
TRN  10010111100111011
NAM  Q17302_CAEBR/170-270
ASQ  FGSNRPAIFLHDFKQNLTAIVDTVGNRCFVKDLDRTKIRSPRMLIEMLRNIDIMAPEVAYAQTRMVRETY--------NVGDELTKADISTFNSTILSRHCAFRQTYKL
DSQ  TTTGGATCTAACCGACCCGCGATCTTCTTGCACGATTTCAAACAGAACCTCACCGCTATTGTTGATACTGTTGGAAACCGTTGCTTTGTCAAGGATTTGGACAGAACCAAGATCCGAAGCCCAAGAATGCTTATTGAGATGCTCAGAAACATTGATATCATGGCCCCAGAAGTAGCCTACGCTCAAACTCGCATGGTCCGAGAAACATAC------------------------AACGTTGGGGATGAGCTCACCAAGGCCGATATCAGCACATTCAACAGTACCATTCTCTCGCGTCACTGTGCTTTCCGTCAAACATACAAGCTT
TRN  10010101110011011
NAM  Q9D0T7_MOUSE/63-155
ASQ  NSVQSEWDGVMDYKNDLLAAKLFSKMACVLAKMDPAAFPSLDDITQALGKQASGHYPPTRG-------------LTYTVLPSRIK--NLAQY-GVPIKDLCRAVPTYFA
DSQ  AACAGCGTTCAGAGTGAATGGGATGGAGTCATGGACTACAAGAACGACCTCCTGGCAGCTAAGCTGTTTAGCAAGATGGCCTGTGTTCTGGCAAAGATGGACCCAGCAGCCTTCCCAAGTTTGGATGATATTACCCAGGCCCTGGGCAAACAGGCTTCCGGTCACTACCCACCTACTCGAGGA---------------------------------------CTGACCTACACAGTTTTACCCAGCCGAATCAAA------AACTTGGCCCAATAC---GGAGTGCCAATCAAAGACCTGTGCAGAGCCGTCCCCACCTACTTTGCT
TRN  10010101100011010
NAM  GKN1_MOUSE/54-148
ASQ  NNGWDSWNSLWDYENSFAATRLFSKKSCIVHRMNKDAMPSLQDLDTMVKEQKGKGPGGA-----------PPKDLMYSVNPTRVE--DLNTF-GPKIAGMCRGIPTYVA
DSQ  AATAACGGCTGGGACTCCTGGAATAGCCTCTGGGACTATGAAAACAGTTTCGCTGCCACGAGACTCTTCTCCAAGAAGTCATGCATTGTGCACAGAATGAACAAGGATGCCATGCCCTCCCTTCAGGACCTCGATACAATGGTCAAGGAACAGAAGGGTAAAGGGCCTGGAGGAGCT---------------------------------CCTCCCAAGGACTTGATGTACTCCGTCAACCCTACCAGAGTGGAG------GACCTGAATACATTC---GGACCAAAGATTGCTGGCATGTGCAGGGGCATCCCTACCTATGTGGCC
TRN  10010101100011001
NAM  GKN1_HUMAN/54-150
ASQ  NNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGP---------PPKGLMYSVNPNKVD--DLSKF-GKNIANMCRGIPTYMA
DSQ  AACAACGGATGGGACTCCTGGAATTCCATCTGGGATTATGGAAATGGCTTTGCTGCAACCAGACTCTTTCAAAAGAAGACATGCATTGTGCACAAAATGAACAAGGAAGTCATGCCCTCCATTCAATCCCTTGATGCACTGGTCAAGGAAAAGAAGCTTCAGGGTAAGGGACCAGGAGGACCA---------------------------CCTCCCAAGGGCCTGATGTACTCAGTCAACCCAAACAAAGTCGAT------GACCTGAGCAAGTTC---GGAAAAAACATTGCAAACATGTGTCGTGGGATTCCAACATACATGGCT
TRN  10010101100011001
NAM  Q9CQS6_MOUSE/54-151
ASQ  HSGSCSSTTIFDYKHGYIASRVLSRRACYVIKMDHKAIPALDKLQRFLYEKQTMNAIDSPEYT----------WVRYNPLKSLITKVDWFLF-GSPIRQLCKHMPLYEG
DSQ  CACTCAGGCTCGTGCTCCTCCACCACGATTTTTGACTATAAGCATGGTTACATCGCATCCCGGGTGCTCTCCCGGAGAGCCTGTTACGTCATCAAGATGGACCACAAAGCCATCCCTGCTCTGGACAAACTCCAACGGTTCCTCTACGAGAAGCAGACAATGAATGCTATCGACTCCCCAGAGTATACC------------------------------TGGGTCAGGTACAACCCTCTGAAGTCTCTGATCACGAAGGTGGACTGGTTCCTGTTT---GGGTCGCCTATTCGACAGCTATGCAAGCACATGCCCCTGTATGAGGGT
TRN  10010101100011001
//