EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04083 - Abhydro_lipase)
FAM  PF04083
PID  Abhydro_lipase
DES  ab-hydrolase associated lipase region
IPR  IPR006693
ANO  13
ALN  72
AID  0.429013
APH  (((((((O61866_CAEEL/21-92:0.23449,Q20449_CAEEL/27-98:0.11811):0.26947,(LIPG_MOUSE/26-96:0.11986,LIPG_BOVIN/26-96:0.18765):0.15853):0.08903,((LICH_HUMAN/29-99:0.12219,LICH_MOUSE/27-97:0.22886):0.04789,O17766_CAEEL/21-92:0.66601):0.05312):0.23930,Q9LPR1_ARATH/24-79:0.71959):0.27127,(Q9SKL5_ARATH/26-92:0.74863,O60095_SCHPO/67-138:0.74290):0.31764):0.14032,LIP1_DROME/60-122:0.27261):0.22619,Q9VKT2_DROME/34-96:0.29530,Q9VKT9_DROME/63-125:0.12663);
ATP  (((((((O61866_CAEEL/21-92,Q20449_CAEEL/27-98),(LIPG_MOUSE/26-96,LIPG_BOVIN/26-96)),((LICH_HUMAN/29-99,LICH_MOUSE/27-97),O17766_CAEEL/21-92)),Q9LPR1_ARATH/24-79),(Q9SKL5_ARATH/26-92,O60095_SCHPO/67-138)),LIP1_DROME/60-122),Q9VKT2_DROME/34-96,Q9VKT9_DROME/63-125);
ATL  6.41118
DNO  13
DLN  216
DID  0.488245
DPH  ((((((((LICH_HUMAN/29-99:0.08385,LICH_MOUSE/27-97:0.13717):0.10125,(LIPG_MOUSE/26-96:0.08051,LIPG_BOVIN/26-96:0.20057):0.19080):0.14748,(O61866_CAEEL/21-92:0.23765,Q20449_CAEEL/27-98:0.17678):0.12850):0.10615,O17766_CAEEL/21-92:0.45562):0.22245,Q9LPR1_ARATH/24-79:0.46656):0.06433,(Q9SKL5_ARATH/26-92:0.66944,O60095_SCHPO/67-138:0.43703):0.20791):0.27651,LIP1_DROME/60-122:0.23366):0.11773,Q9VKT2_DROME/34-96:0.25473,Q9VKT9_DROME/63-125:0.19242);
DTP  ((((((((LICH_HUMAN/29-99,LICH_MOUSE/27-97),(LIPG_MOUSE/26-96,LIPG_BOVIN/26-96)),(O61866_CAEEL/21-92,Q20449_CAEEL/27-98)),O17766_CAEEL/21-92),Q9LPR1_ARATH/24-79),(Q9SKL5_ARATH/26-92,O60095_SCHPO/67-138)),LIP1_DROME/60-122),Q9VKT2_DROME/34-96,Q9VKT9_DROME/63-125);
DTL  5.1891
RID  0.429013
RPH  (((((((O61866_CAEEL/21-92:0.23449,Q20449_CAEEL/27-98:0.11811):0.26947,(LIPG_MOUSE/26-96:0.11986,LIPG_BOVIN/26-96:0.18765):0.15853):0.08903,((LICH_HUMAN/29-99:0.12219,LICH_MOUSE/27-97:0.22886):0.04789,O17766_CAEEL/21-92:0.66601):0.05312):0.23930,Q9LPR1_ARATH/24-79:0.71959):0.27127,(Q9SKL5_ARATH/26-92:0.74863,O60095_SCHPO/67-138:0.74290):0.31764):0.14032,LIP1_DROME/60-122:0.27261):0.22619,Q9VKT2_DROME/34-96:0.29530,Q9VKT9_DROME/63-125:0.12663);
RTP  (((((((O61866_CAEEL/21-92,Q20449_CAEEL/27-98),(LIPG_MOUSE/26-96,LIPG_BOVIN/26-96)),((LICH_HUMAN/29-99,LICH_MOUSE/27-97),O17766_CAEEL/21-92)),Q9LPR1_ARATH/24-79),(Q9SKL5_ARATH/26-92,O60095_SCHPO/67-138)),LIP1_DROME/60-122),Q9VKT2_DROME/34-96,Q9VKT9_DROME/63-125);
RTL  6.41118
LNK  LICH_HUMAN/29-99:P38571:M74775
LNK  LICH_MOUSE/27-97:Q9Z0M5:Z31689
LNK  LIP1_DROME/60-122:O46107:AE003629
LNK  LIPG_BOVIN/26-96:Q29458:L26319
LNK  LIPG_MOUSE/26-96:Q9CPP7:AK009300
LNK  O17766_CAEEL/21-92:O17766:Z81055
LNK  O60095_SCHPO/67-138:O60095:AL022305
LNK  O61866_CAEEL/21-92:O61866:AF067942
LNK  Q20449_CAEEL/27-98:Q20449:Z70780
LNK  Q9LPR1_ARATH/24-79:Q9LPR1:AC013354
LNK  Q9SKL5_ARATH/26-92:Q9SKL5:AC006298
LNK  Q9VKT2_DROME/34-96:Q9VKT2:AE003629
LNK  Q9VKT9_DROME/63-125:Q9VKT9:AE003629
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q20449_CAEEL/27-98
ASQ  DDPELNMNTSQIIERWGYKAEVHTVTTEDGYILQMQRIPYGKTSVTWpNGKRPVILLQHGLLACASDWVDNL
DSQ  GATGATCCAGAACTTAATATGAATACGAGTCAAATCATTGAACGATGGGGATATAAAGCAGAAGTTCATACAGTCACTACGGAAGATGGATATATTCTTCAAATGCAGAGAATTCCTTATGGAAAAACGAGTGTTACATGGccaAATGGGAAAAGACCAGTTATTTTACTGCAGCACGGGTTGCTAGCATGTGCCAGTGATTGGGTTGATAATTTA
TRN  10010101100011010
NAM  O61866_CAEEL/21-92
ASQ  GDPELHMTTPQIIERWGYPAMIYTVATDDGYILEMHRIPFGKTNVTWpNGKRPVVFMQHGLLCASSDWVVNL
DSQ  GGCGACCCAGAGCTTCATATGACTACCCCCCAAATCATCGAGCGATGGGGGTATCCGGCGATGATCTACACAGTTGCCACGGATGATGGGTACATTTTGGAAATGCACAGAATTCCATTTGGGAAAACAAACGTAACATGGccaAATGGCAAGAGACCTGTCGTCTTCATGCAACACGGCCTGCTGTGCGCCTCTAGCGACTGGGTCGTGAACCTT
TRN  10010101100011011
NAM  LIPG_BOVIN/26-96
ASQ  KNPEASMNVSQMISYWGYPSEMHKVITADGYILQVYRIPHGKNNANH.LGQRPVVFLQHGLLGSATNWISNL
DSQ  AAGAACCCTGAAGCCAGTATGAATGTTAGTCAGATGATTTCCTACTGGGGCTACCCAAGTGAGATGCATAAAGTTATAACTGCGGATGGTTATATCCTTCAGGTCTATCGGATTCCTCATGGAAAGAATAATGCTAATCAT...TTAGGTCAGAGACCTGTTGTGTTTCTGCAGCATGGTCTTCTTGGATCAGCCACAAACTGGATTTCCAACCTG
TRN  10010101100011000
NAM  LIPG_MOUSE/26-96
ASQ  KNPEANMNVSQMITYWGYPSEEYEVVTEDGYILGVYRIPYGKKN-SEnIGKRPVAYLQHGLIASATNWITNL
DSQ  AAAAACCCTGAAGCAAACATGAATGTTAGTCAGATGATAACTTACTGGGGATATCCAAGTGAGGAATATGAAGTTGTTACTGAAGATGGCTACATTCTGGGGGTCTATAGAATTCCTTATGGGAAGAAAAAT---TCTGAGaatATCGGCAAGAGACCTGTGGCATATTTGCAGCATGGTTTGATTGCATCAGCCACAAACTGGATTACAAATCTG
TRN  10010101100011001
NAM  LICH_MOUSE/27-97
ASQ  VDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGWKNHFG.KGPRPVVYLQHGLLADSSNWVTNI
DSQ  GTGGATCCTGAAGTCAACATGAATGTGACCGAGATAATCATGCGCTGGGGATATCCTGGTGAGGAACACTCGGTCCTGACAGGAGATGGCTATATTCTGAGTATTCACCGAATCCCTCGTGGGTGGAAGAACCATTTTGGC...AAAGGTCCCAGACCAGTTGTGTATCTTCAGCACGGCTTGCTGGCAGATTCTAGTAACTGGGTCACAAACATT
TRN  10010101100011011
NAM  LICH_HUMAN/29-99
ASQ  VDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSD.KGPKPVVFLQHGLLADSSNWVTNL
DSQ  GTGGATCCTGAAACAAACATGAATGTGAGTGAAATTATCTCTTACTGGGGATTCCCTAGTGAGGAATACCTAGTTGAGACAGAAGATGGATATATTCTGTGCCTTAACCGAATTCCTCATGGGAGGAAGAACCATTCTGAC...AAAGGTCCCAAACCAGTTGTCTTCCTGCAACATGGCTTGCTGGCAGATTCTAGTAACTGGGTCACAAACCTT
TRN  10010101100011011
NAM  O17766_CAEEL/21-92
ASQ  IDDECYMTVPEIGKHFGYESEVHLVRTTDEYILELHRIPCKQNEKCDrSSKRPIVFMQHGLLADGFSWIPNL
DSQ  ATTGACGATGAATGTTACATGACTGTGCCAGAAATAGGAAAACACTTTGGGTATGAATCAGAAGTACATTTAGTGAGAACAACGGATGAGTATATTCTGGAACTTCACAGAATCCCATGTAAACAAAATGAAAAATGTGACagaAGCTCAAAACGTCCAATAGTATTCATGCAACACGGCCTCCTTGCGGACGGATTCTCTTGGATTCCGAATCTA
TRN  10010101100011000
NAM  Q9VKT9_DROME/63-125
ASQ  IQEDSHLNTYSLIKKYGYPAENHTLETDDGYILTLHRIAR-------.-PGATPVLLVHGLLDSSATWVMMG
DSQ  ATTCAGGAGGATTCACACTTGAATACCTACAGTCTGATAAAAAAGTACGGCTACCCGGCGGAGAATCACACCTTGGAGACGGATGATGGATACATCCTCACCTTGCACAGGATCGCTAGA---------------------...---CCGGGAGCAACGCCAGTGCTTCTGGTGCACGGACTACTGGATAGCTCAGCCACTTGGGTGATGATGGGA
TRN  10010101100011001
NAM  Q9VKT2_DROME/34-96
ASQ  VIEDAHLNTIQLLEKYKHPAETHQVTTDDKYILTLHRIAR-------.-PGAKPVLLVHGLEDTSSTWIVMG
DSQ  GTGATTGAGGATGCTCACCTGAATACGATACAACTACTGGAAAAGTACAAGCATCCAGCGGAGACCCACCAGGTGACCACCGATGATAAATATATCCTTACCCTTCATCGCATAGCTCGA---------------------...---CCTGGAGCCAAGCCAGTTCTGCTGGTTCACGGACTGGAGGACACCTCTTCCACTTGGATCGTAATGGGT
TRN  10010101100011011
NAM  LIP1_DROME/60-122
ASQ  IKQDSTLSVDKLIAKYGYESEVHHVTTEDGYILTMHRIRK-------.-QGAPPFLLQHGLVDSSAGFVVMG
DSQ  ATCAAACAGGATTCGACTCTCAGTGTGGACAAATTAATCGCCAAGTACGGCTACGAGTCGGAGGTGCACCATGTGACCACCGAGGACGGATACATTCTCACCATGCATCGCATCCGCAAG---------------------...---CAGGGCGCCCCGCCCTTCCTCCTGCAGCACGGACTCGTGGACAGCTCGGCGGGATTTGTGGTAATGGGG
TRN  11011101101011010
NAM  Q9LPR1_ARATH/24-79
ASQ  FNFSYNLDR--------YPYEAIRVVTSDGYGLLLERIP--RRD---.--ARKAVYLQHGVMDSSMGWVSNG
DSQ  TTTAACTTCTCTTATAATCTTGATAGG------------------------TATCCATATGAAGCTATTCGTGTTGTTACATCTGATGGATATGGTCTTCTCTTGGAAAGGATACCA------AGACGAGAT---------...------GCGAGGAAAGCTGTTTATTTGCAGCATGGTGTAATGGATTCTTCAATGGGATGGGTATCAAATGGT
TRN  10010101110011001
NAM  O60095_SCHPO/67-138
ASQ  NKLTDARDTIDLCALHGYDLEEHFVRTTDGYLLGLHRVYKKKKGKIEeLNYLPPVLFIHGLMMNSESWVCNL
DSQ  AATAAATTAACTGATGCAAGAGATACCATCGATTTATGTGCACTTCATGGGTATGATCTGGAAGAACACTTTGTTCGTACAACTGATGGCTACTTGCTTGGCTTGCATCGGGTGTATAAAAAGAAAAAAGGAAAAATTGAAgagTTAAATTATCTCCCACCTGTATTATTTATTCATGGGCTAATGATGAACTCTGAAAGTTGGGTCTGCAACTTG
TRN  10010101100011010
NAM  Q9SKL5_ARATH/26-92
ASQ  GSPVNSLCA-DLIHPANYSCTEHSIQTKDGYILALQRVASLGPR---.LQSGPPVLLQHGLFMAGDVWFLNS
DSQ  GGATCTCCGGTCAATTCTCTCTGCGCT---GATCTCATTCATCCCGCTAATTACTCCTGCACTGAACACAGTATTCAAACAAAGGATGGTTACATATTAGCTCTTCAACGTGTAGCTTCTCTTGGTCCAAGA---------...CTTCAATCTGGTCCACCTGTTTTGCTTCAGCACGGTCTCTTTATGGCTGGAGATGTGTGGTTCTTGAATTCA
TRN  10010101110011000
//