EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04077 - DsrH)
FAM  PF04077
PID  DsrH
DES  DsrH like protein
IPR  IPR007215
ANO  7
ALN  98
AID  0.272818
APH  (((O27413_METTH/10-106:1.29393,Q9X074_THEMA/1-87:1.98161):0.07912,(Q9KV00_VIBCH/4-90:1.17022,(Q9I0N1_PSEAE/10-99:0.83752,O87898_CHRVI/9-100:0.49372):0.21019):0.11834):0.24262,Y530_BUCAI/2-89:0.69903,YHEL_ECOLI/7-94:0.30951);
ATP  (((O27413_METTH/10-106,Q9X074_THEMA/1-87),(Q9KV00_VIBCH/4-90,(Q9I0N1_PSEAE/10-99,O87898_CHRVI/9-100))),Y530_BUCAI/2-89,YHEL_ECOLI/7-94);
ATL  7.43937
DNO  7
DLN  294
DID  0.388237
DPH  ((YHEL_ECOLI/7-94:0.19247,(Q9I0N1_PSEAE/10-99:0.50754,O87898_CHRVI/9-100:0.29776):0.36625):0.22265,(Q9KV00_VIBCH/4-90:0.86344,Y530_BUCAI/2-89:0.39364):0.05343,(Q9X074_THEMA/1-87:0.78689,O27413_METTH/10-106:0.64510):0.16127);
DTP  ((YHEL_ECOLI/7-94,(Q9I0N1_PSEAE/10-99,O87898_CHRVI/9-100)),(Q9KV00_VIBCH/4-90,Y530_BUCAI/2-89),(Q9X074_THEMA/1-87,O27413_METTH/10-106));
DTL  4.49045
RID  0.272818
RPH  (((O27413_METTH/10-106:1.29393,Q9X074_THEMA/1-87:1.98161):0.07912,(Q9KV00_VIBCH/4-90:1.17022,(Q9I0N1_PSEAE/10-99:0.83752,O87898_CHRVI/9-100:0.49372):0.21019):0.11834):0.24262,Y530_BUCAI/2-89:0.69903,YHEL_ECOLI/7-94:0.30951);
RTP  (((O27413_METTH/10-106,Q9X074_THEMA/1-87),(Q9KV00_VIBCH/4-90,(Q9I0N1_PSEAE/10-99,O87898_CHRVI/9-100))),Y530_BUCAI/2-89,YHEL_ECOLI/7-94);
RTL  7.43937
LNK  O27413_METTH/10-106:O27413:AE000898
LNK  O87898_CHRVI/9-100:O87898:U84760
LNK  Q9I0N1_PSEAE/10-99:Q9I0N1:AE004689
LNK  Q9KV00_VIBCH/4-90:Q9KV00:AE004124
LNK  Q9X074_THEMA/1-87:Q9X074:AE001760
LNK  Y530_BUCAI/2-89:P57596:AP001119
LNK  YHEL_ECOLI/7-94:P45530:U18997
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O87898_CHRVI/9-100
ASQ  KSPFERNS---LESCLKFATEGASVLLFEDGIYAALAGTRVESQVTEALGKLKLYVLGPDLKARGFSDERVIPGISVVDY---AGFVDLTTECDTVQA
DSQ  AAATCACCCTTCGAGCGGAATTCG---------TTAGAATCCTGCCTGAAGTTTGCCACCGAGGGCGCGAGCGTCCTGCTGTTCGAGGATGGCATCTATGCCGCGCTCGCGGGTACCCGCGTCGAGTCTCAAGTGACCGAGGCGCTCGGCAAGCTCAAGCTGTACGTGCTCGGCCCCGACCTCAAGGCCCGGGGCTTCAGTGATGAGCGCGTCATTCCAGGGATCAGCGTCGTGGACTAC---------GCCGGCTTCGTCGATCTGACGACCGAGTGCGATACCGTCCAGGCC
TRN  11011101101011000
NAM  Q9I0N1_PSEAE/10-99
ASQ  RSPFNDGR---LGSCLYLLNPGDGLLLCGDAVHALLAGSHACQALELMPAEIELFALLEDLQARGIED--VPARLVAVDY---PGFVELATRFDKVNS
DSQ  CGCTCGCCGTTCAATGACGGCCGC---------CTGGGCAGTTGCCTGTACCTGCTCAACCCCGGCGACGGCCTGCTGCTCTGCGGCGACGCCGTGCACGCCCTGCTGGCCGGCAGCCACGCCTGCCAGGCCCTGGAACTGATGCCGGCGGAAATCGAACTGTTCGCCCTGCTGGAAGACCTCCAGGCGCGCGGTATCGAGGAC------GTCCCCGCTCGCCTGGTGGCGGTGGACTAC---------CCCGGCTTCGTCGAACTCGCCACCCGCTTCGACAAGGTCAACAGT
TRN  11011111101111111
NAM  YHEL_ECOLI/7-94
ASQ  RSPWLTD----FAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAP--IKVYALNEDLIARGLTGQ-ISNDIILIDY---TDFVRLTVKHPSQMA
DSQ  CGCTCACCCTGGCTGACGGAT------------TTTGCTGCGCTGCTGCGTCTGCTCAGTGAAGGAGACGAACTGCTATTATTGCAAGATGGCGTAACTGCCGCAGTTGACGGTAACCGCTACCTTGAAAGTCTGCGTAATGCCCCC------ATTAAGGTCTATGCCCTGAACGAAGACCTTATTGCCCGCGGTTTGACTGGTCAA---ATTTCGAACGACATCATTCTCATTGACTAT---------ACTGATTTCGTCAGACTTACGGTTAAGCACCCCAGCCAGATGGCC
TRN  10010101100011000
NAM  Y530_BUCAI/2-89
ASQ  KSPFETN----VSLVISMLKKSDDFLALQDGVLIALKDNIFLKSIIMSP--VKLYLIKEDVYARGIRKN-ISREFILINY---IHFVSLTLKHKKQMT
DSQ  AAATCTCCTTTTGAGACTAAT------------GTTTCTCTTGTGATAAGTATGTTAAAAAAATCAGATGATTTTTTAGCTCTTCAAGATGGTGTGCTAATTGCATTAAAAGATAATATTTTTTTAAAGAGTATAATTATGTCTCCA------GTGAAATTATATCTTATAAAAGAAGATGTTTATGCGCGAGGAATCAGAAAAAAT---ATTTCTAGAGAATTTATTTTAATCAATTAT---------ATCCATTTCGTTTCATTAACACTTAAACATAAAAAACAAATGACT
TRN  10010101110011000
NAM  Q9KV00_VIBCH/4-90
ASQ  IVKHLEK----LPLLSAYLLDGDVVLLTENAVYAAAVHSPYQASINDQN---LWLVLYEDLHARGWLEK-CDPRISVVTM---SDFVDLTVTHDKSIT
DSQ  ATTGTTAAGCACTTAGAAAAA------------CTCCCTTTGCTTAGTGCTTATTTACTCGATGGTGATGTTGTTCTATTGACGGAGAATGCTGTCTACGCGGCGGCAGTACATTCACCATATCAAGCGAGTATTAACGATCAGAAC---------CTATGGTTGGTGCTTTATGAGGATCTGCATGCGCGTGGTTGGCTAGAAAAG---TGCGATCCGCGTATTTCGGTTGTCACCATG---------AGTGACTTTGTTGATTTGACAGTAACTCATGATAAATCAATAACC
TRN  10010101100011000
NAM  O27413_METTH/10-106
ASQ  KSPSELSFKTFLDLVDIWCEEYLKVYLISNGIYAAMEGNRYSHTIREISRTGNVFARKEDLMARGITRE-MLIDGVEVLEGLDRVVVDIMENLDMVFT
DSQ  AAGAGCCCTTCAGAGCTCAGCTTCAAAACATTTCTGGACCTCGTGGATATCTGGTGCGAAGAGTACCTGAAGGTGTATCTGATATCAAATGGAATATATGCTGCAATGGAAGGAAACAGGTACTCCCACACCATCCGGGAGATTTCAAGGACCGGGAATGTTTTTGCAAGGAAGGAAGATCTAATGGCAAGGGGTATAACCCGAGAA---ATGCTCATAGATGGTGTGGAAGTACTTGAAGGCCTTGACAGGGTGGTTGTTGATATAATGGAAAACCTGGATATGGTCTTCACA
TRN  10010101100011001
NAM  Q9X074_THEMA/1-87
ASQ  MALVLVK----YGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETP--AKVYAIKDDFLARGYSE--EDSKVPLITY---SEFIDLLEGEEKFIG
DSQ  ATGGCACTCGTACTCGTTAAG------------TACGGAACGGATCACCCAGTGGAAAAACTCAAAATAAGATCTGCAAAGGCAGAAGATAAGATAGTTCTCATACAAAACGGTGTCTTCTGGGCTCTGGAAGAACTCGAAACACCA------GCAAAGGTCTACGCAATCAAGGACGATTTTCTTGCGAGAGGATATTCCGAA------GAGGATTCAAAAGTTCCACTGATCACTTAC---------AGTGAATTCATAGATCTTCTGGAGGGTGAAGAGAAATTCATCGGC
TRN  10010101100011001
//