EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04060 - FeS)
FAM  PF04060
PID  FeS
DES  Putative Fe-S cluster
IPR  IPR007202
ANO  20
ALN  35
AID  0.425148
APH  ((((((((((ACDG_METTH/11-45:0.08040,ACDG_METJA/13-47:0.24648):0.23451,(O28038_ARCFU/117-151:0.27152,O28624_ARCFU/11-45:0.14520):0.12613):0.03359,(ACDG1_METTE/12-46:0.12599,ACDG_ARCFU/12-46:0.40065):0.18825):0.08478,ACSC_MOOTH/10-44:0.53109):0.05105,O27412_METTH/137-171:0.20137):0.50567,Y119_METJA/20-54:0.20336):0.50530,O27707_METTH/14-48:0.15547):0.40946,(((((RNFB_HAEIN/40-73:0.13230,RNFB_BUCAI/39-73:0.24493):0.11650,RNFB_PSEAE/43-76:0.00000):0.27094,(Q9JX52_NEIMA/11-44:0.33446,Q9PFW0_XYLFA/36-70:0.09557):0.14951):0.31402,RNFB_RHOCA/40-74:0.51550):0.17407,Q9WY91_THEMA/45-79:0.11374):0.12190):0.16662,O74080_PYRHO/156-189:0.54779):0.70420,O27594_METTH/141-175:0.34622,Q50745_METTF/141-175:0.00000);
ATP  ((((((((((ACDG_METTH/11-45,ACDG_METJA/13-47),(O28038_ARCFU/117-151,O28624_ARCFU/11-45)),(ACDG1_METTE/12-46,ACDG_ARCFU/12-46)),ACSC_MOOTH/10-44),O27412_METTH/137-171),Y119_METJA/20-54),O27707_METTH/14-48),(((((RNFB_HAEIN/40-73,RNFB_BUCAI/39-73),RNFB_PSEAE/43-76),(Q9JX52_NEIMA/11-44,Q9PFW0_XYLFA/36-70)),RNFB_RHOCA/40-74),Q9WY91_THEMA/45-79)),O74080_PYRHO/156-189),O27594_METTH/141-175,Q50745_METTF/141-175);
ATL  9.05121
DNO  20
DLN  105
DID  0.482987
DPH  (((((((((ACSC_MOOTH/10-44:0.45779,((ACDG_ARCFU/12-46:0.34215,O28624_ARCFU/11-45:0.25113):0.08637,O28038_ARCFU/117-151:0.20035):0.10325):0.02561,O27412_METTH/137-171:0.24362):0.02787,ACDG1_METTE/12-46:0.25536):0.05732,(ACDG_METTH/11-45:0.15310,ACDG_METJA/13-47:0.20308):0.14980):0.30288,Y119_METJA/20-54:0.27326):0.18659,O27707_METTH/14-48:0.31106):0.14163,(((((RNFB_HAEIN/40-73:0.13167,RNFB_BUCAI/39-73:0.25100):0.31339,RNFB_PSEAE/43-76:0.05993):0.12769,(Q9JX52_NEIMA/11-44:0.16948,Q9PFW0_XYLFA/36-70:0.20198):0.09485):0.19143,RNFB_RHOCA/40-74:0.25206):0.19020,Q9WY91_THEMA/45-79:0.20222):0.15698):0.09857,O74080_PYRHO/156-189:0.48795):0.36546,O27594_METTH/141-175:0.32339,Q50745_METTF/141-175:0.04381);
DTP  (((((((((ACSC_MOOTH/10-44,((ACDG_ARCFU/12-46,O28624_ARCFU/11-45),O28038_ARCFU/117-151)),O27412_METTH/137-171),ACDG1_METTE/12-46),(ACDG_METTH/11-45,ACDG_METJA/13-47)),Y119_METJA/20-54),O27707_METTH/14-48),(((((RNFB_HAEIN/40-73,RNFB_BUCAI/39-73),RNFB_PSEAE/43-76),(Q9JX52_NEIMA/11-44,Q9PFW0_XYLFA/36-70)),RNFB_RHOCA/40-74),Q9WY91_THEMA/45-79)),O74080_PYRHO/156-189),O27594_METTH/141-175,Q50745_METTF/141-175);
DTL  7.40763
RID  0.425148
RPH  ((((((((((ACDG_METTH/11-45:0.08040,ACDG_METJA/13-47:0.24648):0.23451,(O28038_ARCFU/117-151:0.27152,O28624_ARCFU/11-45:0.14520):0.12613):0.03359,(ACDG1_METTE/12-46:0.12599,ACDG_ARCFU/12-46:0.40065):0.18825):0.08478,ACSC_MOOTH/10-44:0.53109):0.05105,O27412_METTH/137-171:0.20137):0.50567,Y119_METJA/20-54:0.20336):0.50530,O27707_METTH/14-48:0.15547):0.40946,(((((RNFB_HAEIN/40-73:0.13230,RNFB_BUCAI/39-73:0.24493):0.11650,RNFB_PSEAE/43-76:0.00000):0.27094,(Q9JX52_NEIMA/11-44:0.33446,Q9PFW0_XYLFA/36-70:0.09557):0.14951):0.31402,RNFB_RHOCA/40-74:0.51550):0.17407,Q9WY91_THEMA/45-79:0.11374):0.12190):0.16662,O74080_PYRHO/156-189:0.54779):0.70420,O27594_METTH/141-175:0.34622,Q50745_METTF/141-175:0.00000);
RTP  ((((((((((ACDG_METTH/11-45,ACDG_METJA/13-47),(O28038_ARCFU/117-151,O28624_ARCFU/11-45)),(ACDG1_METTE/12-46,ACDG_ARCFU/12-46)),ACSC_MOOTH/10-44),O27412_METTH/137-171),Y119_METJA/20-54),O27707_METTH/14-48),(((((RNFB_HAEIN/40-73,RNFB_BUCAI/39-73),RNFB_PSEAE/43-76),(Q9JX52_NEIMA/11-44,Q9PFW0_XYLFA/36-70)),RNFB_RHOCA/40-74),Q9WY91_THEMA/45-79)),O74080_PYRHO/156-189),O27594_METTH/141-175,Q50745_METTF/141-175);
RTL  9.05121
LNK  ACDG1_METTE/12-46:Q50539:U30484
LNK  ACDG_ARCFU/12-46:O29871:AE001078
LNK  ACDG_METJA/13-47:Q57576:U67468
LNK  ACDG_METTH/11-45:O27748:AE000928
LNK  ACSC_MOOTH/10-44:Q07340:L07099
LNK  O27412_METTH/137-171:O27412:AE000898
LNK  O27594_METTH/141-175:O27594:AE000915
LNK  O27707_METTH/14-48:O27707:AE000925
LNK  O28038_ARCFU/117-151:O28038:AE000950
LNK  O28624_ARCFU/11-45:O28624:AE000989
LNK  O74080_PYRHO/156-189:O74080:BA000001
LNK  Q50745_METTF/141-175:Q50745:X87968
LNK  Q9JX52_NEIMA/11-44:Q9JX52:AL162752
LNK  Q9PFW0_XYLFA/36-70:Q9PFW0:AE003902
LNK  Q9WY91_THEMA/45-79:Q9WY91:AE001708
LNK  RNFB_BUCAI/39-73:P57214:AP001118
LNK  RNFB_HAEIN/40-73:P71396:U32841
LNK  RNFB_PSEAE/43-76:Q9HYB9:AE004770
LNK  RNFB_RHOCA/40-74:Q07394:X72888
LNK  Y119_METJA/20-54:Q57583:U67469
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q50745_METTF/141-175
ASQ  LLQDLNCGKCGFESCREFAKAKVQGDADDTNCKSQ
DSQ  CTCCTTCAGGACCTCAACTGCGGTAAGTGCGGCTTTGAATCATGCAGAGAGTTTGCAAAGGCAAAGGTTCAGGGTGATGCAGATGATACAAACTGTAAGAGCCAG
TRN  10010101110011001
NAM  O27594_METTH/141-175
ASQ  LLQNLNCKKCGFSSCREFREAKIRGEADDIDCRSQ
DSQ  CTGTTGCAGAACCTCAACTGCAAAAAATGCGGGTTCAGTTCATGCAGAGAGTTCAGAGAGGCCAAGATCCGTGGCGAGGCTGATGATATCGACTGCAGGAGTCAG
TRN  10010101100011001
NAM  ACSC_MOOTH/10-44
ASQ  QLPKKNCGECGTPTCLAFAMNLASGKASLDSCPYV
DSQ  CAGCTACCCAAAAAGAATTGTGGCGAGTGCGGGACACCCACCTGTCTGGCCTTCGCCATGAACCTGGCCTCCGGAAAGGCCAGCCTTGATTCCTGTCCGTATGTT
TRN  11011101101011011
NAM  Y119_METJA/20-54
ASQ  YLPGFNCGACGYKRCDLFAEALLNKDVKLEDCPFL
DSQ  TATCTTCCAGGATTCAATTGTGGAGCTTGTGGTTATAAGAGATGTGATTTATTTGCTGAGGCATTATTAAATAAAGATGTAAAATTAGAGGACTGCCCATTTTTG
TRN  10010101110011010
NAM  ACDG_METJA/13-47
ASQ  LLPKTNCKKCGYPSCMAFATKLLEKEATIDQCPIL
DSQ  TTACTGCCAAAAACAAACTGTAAAAAATGCGGTTATCCGTCATGCATGGCATTTGCTACAAAACTGTTAGAGAAAGAGGCAACAATTGACCAATGTCCTATATTA
TRN  10010101100011000
NAM  ACDG_METTH/11-45
ASQ  LLPKTNCGKCNEASCMAFATKLIEKEVTLDDCPQL
DSQ  TTACTTCCAAAAACAAACTGTGGTAAATGCAATGAGGCCTCATGCATGGCATTTGCCACAAAACTCATAGAAAAGGAGGTCACCCTTGATGACTGCCCACAGCTC
TRN  10010101110011000
NAM  O28624_ARCFU/11-45
ASQ  LLPKTNCKKCGEATCMSFAFKLLNREKKLEDCKPL
DSQ  CTTTTGCCGAAAACAAACTGCAAGAAATGCGGAGAGGCAACATGCATGAGCTTCGCTTTTAAGCTCCTCAACAGGGAAAAGAAGCTGGAAGATTGTAAGCCGCTT
TRN  10010101100011011
NAM  O28038_ARCFU/117-151
ASQ  YLPKTNCKRCGEQTCMAFAVKLLNGEVDIKACKPL
DSQ  TACCTGCCGAAGACCAACTGCAAGCGGTGCGGCGAGCAGACGTGCATGGCCTTTGCCGTAAAGCTGCTCAACGGAGAGGTTGATATCAAAGCCTGCAAACCTCTT
TRN  11011101101011011
NAM  O27412_METTH/137-171
ASQ  CLPGSNCGDCGESTCMAFAMKLLNGEQKLDSCLPL
DSQ  TGCCTGCCAGGTAGCAACTGCGGTGACTGCGGTGAATCCACGTGCATGGCATTTGCAATGAAGCTGCTCAACGGTGAACAGAAGCTTGACAGCTGCCTGCCACTG
TRN  11011111101111111
NAM  ACDG_ARCFU/12-46
ASQ  YLPRTNCGECGFDTCMSFAAHILDRSVTPLDCKPL
DSQ  TACCTGCCGAGAACTAACTGCGGAGAATGCGGCTTCGACACCTGCATGAGCTTTGCAGCCCACATCCTTGATAGATCAGTAACACCTCTCGACTGCAAGCCGCTT
TRN  10010101100011001
NAM  ACDG1_METTE/12-46
ASQ  YLPQTNCGECGEPTCMAFASKLIDRSGKTSDCPPL
DSQ  TACCTGCCCCAGACCAACTGTGGAGAATGTGGTGAACCTACATGTATGGCATTTGCCTCCAAGCTGATCGACAGGTCCGGCAAGACATCAGACTGCCCACCTCTG
TRN  10010101100011001
NAM  O74080_PYRHO/156-189
ASQ  MLPNIDCGLCGFN-CEQMAKLIVKGEKSVNDCVVL
DSQ  ATGTTACCCAATATAGATTGCGGACTTTGCGGCTTTAAC---TGTGAGCAGATGGCTAAATTAATAGTTAAAGGTGAGAAAAGCGTTAACGATTGTGTCGTTTTA
TRN  10010101110011010
NAM  RNFB_RHOCA/40-74
ASQ  ILPGTNCGACGFPGCNGLAEAMAEGNAPVTACTPG
DSQ  ATCCTGCCCGGCACCAATTGCGGCGCCTGCGGCTTTCCCGGCTGCAACGGTCTGGCCGAGGCGATGGCCGAGGGCAACGCGCCGGTGACCGCCTGCACCCCGGGC
TRN  11011111101111111
NAM  Q9PFW0_XYLFA/36-70
ASQ  LLPQTQCGQCGFQGCLPYAQAMARGEANIDRCPPG
DSQ  TTGCTGCCACAAACACAATGCGGCCAATGCGGCTTTCAAGGCTGCCTCCCGTATGCGCAAGCGATGGCACGTGGCGAAGCCAACATCGACCGCTGCCCTCCCGGC
TRN  11011111101111111
NAM  Q9JX52_NEIMA/11-44
ASQ  LLPQTQCRECGYDGCLPYAQAVATGEA-YNLCAPG
DSQ  CTGCTTCCCCAAACCCAATGCCGCGAATGCGGCTACGACGGCTGCCTGCCCTACGCACAGGCAGTCGCAACAGGCGAAGCG---TACAACCTCTGCGCCCCGGGC
TRN  11011111101111111
NAM  RNFB_BUCAI/39-73
ASQ  LLPQSQCAQCGYSGCYPYAKAIVENSEKINKCIPG
DSQ  CTATTGCCCCAAAGTCAATGTGCTCAATGTGGATATTCTGGATGTTATCCTTACGCAAAAGCAATAGTAGAAAATTCTGAAAAAATTAATAAATGTATTCCTGGT
TRN  10010101110011011
NAM  RNFB_PSEAE/43-76
ASQ  LLPQTQCGQCGYPGCKPYAEAI-AAGDKINKCPPG
DSQ  CTGTTGCCGCAGACCCAGTGCGGCCAGTGTGGCTACCCCGGCTGCAAGCCCTACGCCGAGGCGATC---GCCGCCGGCGACAAGATCAACAAGTGCCCGCCGGGC
TRN  11011111101111111
NAM  RNFB_HAEIN/40-73
ASQ  ILPQSQCGQCGYPGCKPYAEAI-CNGDEITKCIPG
DSQ  ATTTTACCGCAAAGCCAATGTGGGCAATGTGGTTATCCTGGTTGTAAGCCTTATGCTGAAGCCATT---TGCAATGGCGATGAAATCACAAAATGTATTCCAGGT
TRN  11111101111011010
NAM  Q9WY91_THEMA/45-79
ASQ  VLPGINCGACGFAGCEAYAKAIVKGQAETNRCLPG
DSQ  GTTCTTCCTGGAATAAACTGTGGCGCGTGCGGTTTTGCCGGGTGTGAAGCCTACGCGAAGGCGATCGTGAAGGGTCAGGCGGAAACGAACAGGTGTCTCCCCGGA
TRN  10010101110011011
NAM  O27707_METTH/14-48
ASQ  LLPGYNCGICGYARCDEYAAALLKGRAEIDRCHFM
DSQ  CTGCTCCCAGGATACAACTGCGGGATCTGTGGCTATGCAAGGTGTGATGAGTATGCGGCCGCTCTGCTCAAGGGAAGGGCTGAGATCGACAGATGCCACTTCATG
TRN  10010101100011011
//