EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04056 - Ssl1)
FAM  PF04056
PID  Ssl1
DES  Ssl1-like
IPR  IPR007198
ANO  6
ALN  264
AID  0.4104
APH  ((TF2H2_MOUSE/7-255:0.32503,Q9VNP8_DROME/10-258:0.44277):0.08440,((SSL1_YEAST/72-325:0.45782,TFH47_SCHPO/35-287:0.37296):0.22568,Q9ZVN9_ARATH/22-277:0.55809):0.21278,TF2H2_CAEEL/7-259:0.65014);
ATP  ((TF2H2_MOUSE/7-255,Q9VNP8_DROME/10-258),((SSL1_YEAST/72-325,TFH47_SCHPO/35-287),Q9ZVN9_ARATH/22-277),TF2H2_CAEEL/7-259);
ATL  3.32967
DNO  6
DLN  792
DID  0.481015
DPH  (TF2H2_MOUSE/7-255:0.37267,Q9VNP8_DROME/10-258:0.35164,((Q9ZVN9_ARATH/22-277:0.45584,(TFH47_SCHPO/35-287:0.35811,SSL1_YEAST/72-325:0.36967):0.16681):0.13280,TF2H2_CAEEL/7-259:0.46065):0.10271);
DTP  (TF2H2_MOUSE/7-255,Q9VNP8_DROME/10-258,((Q9ZVN9_ARATH/22-277,(TFH47_SCHPO/35-287,SSL1_YEAST/72-325)),TF2H2_CAEEL/7-259));
DTL  2.7709
RID  0.4104
RPH  ((TF2H2_MOUSE/7-255:0.32503,Q9VNP8_DROME/10-258:0.44277):0.08440,((SSL1_YEAST/72-325:0.45782,TFH47_SCHPO/35-287:0.37296):0.22568,Q9ZVN9_ARATH/22-277:0.55809):0.21278,TF2H2_CAEEL/7-259:0.65014);
RTP  ((TF2H2_MOUSE/7-255,Q9VNP8_DROME/10-258),((SSL1_YEAST/72-325,TFH47_SCHPO/35-287),Q9ZVN9_ARATH/22-277),TF2H2_CAEEL/7-259);
RTL  3.32967
LNK  Q9VNP8_DROME/10-258:Q9VNP8:AE003599
LNK  Q9ZVN9_ARATH/22-277:Q9ZVN9:AC005322
LNK  SSL1_YEAST/72-325:Q04673:Z17385
LNK  TF2H2_CAEEL/7-259:P34567:Z30662
LNK  TF2H2_MOUSE/7-255:Q9JIB4:AF242432
LNK  TFH47_SCHPO/35-287:O74995:AF017646
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TF2H2_CAEEL/7-259
ASQ  KGYTWEAGYAEGLNINDVLVEDEGGSIEKSIAKYVADSKRKARLTKRP-----ERIRLGIMRHVMIVIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDFSLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATK-G---EYSVALDPDHLQLLFSKHTLPPSSAKSS--ECNAIHVGFP
DSQ  AAGGGTTACACCTGGGAAGCAGGATATGCAGAAGGCCTGAACATCAATGATGTCCTTGTGGAAGATGAAGGTGGATCTATCGAAAAATCAATTGCCAAATACGTGGCTGATAGCAAACGAAAAGCCCGATTGACGAAGAGACCG---------------GAACGGATTCGCCTCGGAATTATGCGCCACGTCATGATTGTCATCGATTGCTCACGATTCATGACGAGCAAGGCAATGCCTCCATCGAGATTTGTAGTTGTTATGAAGGCTCTACAAACCTTCCTGGACAGATTCTTCGAGCAAAATCCAATTGCTCAGATTGGATTGATCACTTGTAAAGATCGTAAAGCAGATCGGTTGACAATGATGACAGGAAATATTCGTGTGCTAAAAGAATCGCTGAACACACTAACTGAAGCTTTCTGTGGTGGCGATTTTTCTCTTCAAAACGCTCTTCAATTAGCTTGTGCCAACCTGAAAGGAATGCCGGGTCATGTATCACGAGAAGTTGTTCTCGTTATATCAGCACTTTCAACAATTGATCCTGGAAATATTTACAGCACTATTGAGACAATGAAGCGAATGAATATTCGTTGTTCTGCTATTGGACTGTCTGCTGAAATGTTCGTTTGCAAGGAAATGGCTAAAGCAACGAAA---GGA---------GAATATTCCGTAGCTCTTGACCCTGACCATCTGCAACTTTTATTCTCAAAGCATACACTCCCACCGTCCTCAGCAAAATCGAGT------GAATGCAACGCAATTCATGTTGGATTTCCA
TRN  10010101100011000
NAM  TF2H2_MOUSE/7-255
ASQ  RTKRWEGGY---ERTWEILKEDETGSLKATIEDILFKAKRKRVFEHH------GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETG-G---TYHVILDETHYKELLAHHVSPPPASSSS--ECSLIRMGFP
DSQ  AGAACCAAGCGGTGGGAAGGAGGCTAT---------GAGAGAACCTGGGAAATTCTTAAAGAAGATGAAACTGGATCACTTAAAGCTACAATAGAAGATATTCTCTTCAAGGCAAAGAGGAAAAGAGTGTTTGAGCACCAT------------------GGACAAGTCCGACTTGGAATGATGCGCCACCTGTATGTGGTGGTGGATGGATCGAGAACAATGGAAGATCAGGATTTAAAGCCCAATAGACTGACTTGCACTTTAAAGTTGCTGGAATACTTTGTAGAAGAATATTTTGATCAAAACCCTATCAGTCAGATTGGAATAATTGTAACTAAGAGTAAAAGAGCTGAAAAACTGACTGAACTCTCAGGAAACCCAAGGAAACATATAACATCTTTGAAGAAAGCTGTAGATATGACCTGCCATGGAGAACCATCGCTCTATAATTCCTTAAGCATGGCTATGCAGACCCTAAAACACATGCCTGGACATACAAGTAGAGAAGTGCTCATCATCTTCAGCAGCCTCACCACCTGTGATCCATCTAATATTTACGATCTCATCAAGACCCTGAAGACAGCTAAAATTAGAGTGTCTGTTATTGGATTATCTGCGGAGGTTCGAGTTTGTACTGTACTTGCTCGTGAAACTGGT---GGC---------ACATACCATGTTATCTTAGATGAAACCCATTACAAGGAGTTGTTGGCACATCATGTGAGCCCCCCTCCTGCCAGCTCAAGCTCC------GAGTGCTCACTCATTCGCATGGGATTCCCT
TRN  10010101100011000
NAM  Q9VNP8_DROME/10-258
ASQ  KEYRWETGY---EKTWEAIKDDEDGMLDGAIAEIIQKAKRQRQAQKS------KQNRLGMMRHMFVVLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEPSLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTM-G---TFGAVLDDAHFRDQLMSQVDPPPAAKTQ--HNSLIRMGFP
DSQ  AAGGAGTACCGCTGGGAAACGGGCTAT---------GAAAAGACATGGGAGGCCATCAAGGACGACGAGGATGGGATGCTGGATGGAGCCATTGCAGAGATCATTCAGAAGGCCAAACGCCAGAGGCAGGCTCAAAAGTCC------------------AAGCAGAACCGCCTGGGCATGATGCGCCACATGTTCGTTGTGCTCGATTGCTCTGAGTCCATGAGCGTGCCTGATTTGAAACCCACACGACTGCGGTGCACCGTCAAGCTGCTGGAGCTGTTTATCGAGGAGTTCTTCGATCAGAACCCCATCAGCCAATTAGGACTCATAGCGCTAAAAGCTAAGCGAGCGGAGAAGGTGACCGAACTTACCGGCACTTCGCGCGTGCACCTCAAAGCGCTAGAGAGCTTGGCTAACGTGTCCTTGACCAGCGAGCCTTCGCTGCAAAATGGCCTAGATCTGGCCCTAAAATCGCTTAAGGTGGTGCCGTCGCACGCCTCCCGAGAGATCGTCATTATCATGGGCTCGCTCACCACATGTGATCCTGTCGATATTAACCTCACCATCGACGAGTTAAAAAAGGAGGGCATACGCTGCTCGGTTATTTCCCTGTCCGCTGAGATTCACGTGGCCCGCTACCTCACTCAGCAAACAATG---GGC---------ACCTTCGGGGCTGTTTTGGATGATGCACATTTTCGGGATCAACTCATGTCTCAGGTAGATCCACCGCCCGCCGCTAAGACTCAG------CACAACTCGCTTATTCGCATGGGCTTCCCG
TRN  10010101100011010
NAM  SSL1_YEAST/72-325
ASQ  GGYAWEDEI---KRSWDLVKVDDEGDMASLVASIVEARKKRTAKKNI------TPYQRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPLPVNKIN-KGFTLVKMGFP
DSQ  GGTGGGTACGCTTGGGAGGATGAGATC---------AAGAGAAGTTGGGATTTGGTGAAAGTGGACGATGAAGGGGATATGGCATCTCTTGTGGCTAGCATAGTCGAGGCCAGAAAGAAACGTACTGCTAAGAAAAACATA------------------ACGCCATACCAAAGAGGTATTATCAGAAGTTTAATATTAACACTAGATTGTAGTGAAGCTATGTTGGAAAAGGATTTGAGACCAAACAGGCATGCCATGATTATCCAGTACGCCATAGATTTTGTCCATGAATTTTTCGACCAAAATCCGATATCTCAAATGGGTATTATCATAATGAGAAACGGTTTGGCACAACTGGTCAGCCAAGTTAGCGGAAACCCGCAGGATCACATTGATGCGTTGAAATCCATCAGGAAACAAGAACCGAAAGGAAACCCTTCATTGCAAAATGCATTGGAAATGGCAAGAGGCCTTTTATTGCCTGTTCCTGCGCATTGTACAAGGGAAGTACTGATTGTATTTGGTAGTCTTTCCACAACTGATCCTGGAGATATTCACCAAACTATCGATTCGTTAGTTTCTGAGAAAATTAGAGTGAAGGTTTTGGGGTTATCAGCTCAAGTGGCCATATGTAAAGAATTATGCAAGGCAACGAATTATGGTGATGAATCCTTCTATAAAATTTTACTCGATGAAACTCACTTAAAGGAGCTATTTAACGAGGCTGTTACCCCTTTACCCGTTAACAAAATTAAT---AAGGGTTTCACACTCGTAAAGATGGGGTTTCCG
TRN  10010101100011000
NAM  TFH47_SCHPO/35-287
ASQ  EGYTWEGEY---QRSWDIVQEDAEGSLVGVIAGLIQSGKRKRLLRDT------TPLQRGIIRHMVLVLDLSNSMEERDFHHKRFDLQIKYASEFVLEFFEQNPISQLSIIGVMDGIAHRITDLHGNPQSHIQKLKSLR--DCSGNFSLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKTIDALVHDSIRVRIVGLAAEVAICKEICNKTNSSTKNAYGVVISEQHFRELLLESTIPPATDSAKTTDASLVMMGFP
DSQ  GAGGGTTATACTTGGGAAGGTGAATAT---------CAGCGTTCTTGGGATATCGTACAGGAGGACGCAGAGGGTAGTTTAGTAGGCGTTATCGCTGGGCTTATTCAAAGCGGGAAACGTAAAAGACTTCTTAGAGATACA------------------ACTCCGTTACAACGAGGTATTATTAGACACATGGTCTTGGTGTTAGATTTGAGCAACTCTATGGAGGAGCGTGATTTTCATCATAAGCGGTTCGACCTTCAGATAAAGTATGCTTCTGAATTTGTTCTTGAGTTTTTTGAACAAAATCCTATTTCCCAATTATCGATTATAGGCGTAATGGATGGAATCGCTCATCGGATAACTGATTTGCATGGGAATCCTCAATCGCATATTCAGAAGCTTAAATCTCTTCGA------GATTGTAGTGGAAACTTCTCTCTTCAAAATGCTCTCGAAATGGCTAGAGCTTCTTTATCACACATTGCTTCCCATGGCACTAGAGAAGTCCTTATCATTTTTGGTTCCATCTTATCATCAGACCCTGGCGACATTTTCAAGACGATTGATGCTCTGGTTCATGATTCTATTCGTGTCCGTATCGTTGGTTTGGCTGCTGAAGTCGCCATTTGTAAAGAAATTTGTAATAAAACTAACTCATCTACGAAAAATGCCTACGGCGTAGTCATCAGTGAACAACATTTTCGCGAACTTCTACTCGAAAGCACAATACCTCCTGCTACTGATTCGGCTAAAACCACTGATGCTTCTTTGGTAATGATGGGATTTCCT
TRN  10010101100011000
NAM  Q9ZVN9_ARATH/22-277
ASQ  GIGEWERAYVD-DRSWEELQEDESGLLRPIDNSAIYHAQYRRRLRMLSAAAAGTRIQKGLIRYLYIVIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMGKL--EALGDSSLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLRCSVIGLSAEMFICKHLCQETG-G---LYSVAVDEVHLKDLLLEHAPPPPAIAEF-AIANLIKMGFP
DSQ  GGTATCGGCGAGTGGGAGAGAGCTTATGTTGAC---GACCGATCCTGGGAGGAGTTGCAAGAGGATGAGTCTGGACTTTTACGGCCAATTGATAACAGTGCCATTTACCATGCTCAGTATCGCCGCCGTCTTCGTATGCTCTCCGCCGCTGCTGCTGGTACTCGTATCCAAAAGGGACTTATTCGATATCTCTACATCGTCATTGACTTCTCTCGGGCAGCTGCGGAAATGGATTTCAGACCAAGCCGGATGGCTATAATGGCCAAACATGTCGAAGCTTTCATTAGAGAGTTCTTTGACCAGAATCCTCTGAGTCAAATTGGGTTGGTCTCTATAAAAAATGGAGTTGCGCATACATTAACAGATCTTGGTGGTAGTCCTGAGACTCACATCAAAGCGTTGATGGGGAAGTTG------GAAGCTTTGGGTGACTCCTCTTTGCAGAACGCTCTGGAACTTGTACATGAGCATCTCAACCAGGTTCCATCTTATGGTCACCGCGAGGTTCTGATATTGTACTCAGCTTTATGCACATGTGATCCAGGCGATATCATGGAGACCATTCAAAAATGCAAGAAATCCAAATTAAGATGTTCTGTAATTGGGCTCTCTGCAGAAATGTTCATATGTAAACACCTCTGCCAGGAAACTGGC---GGA---------TTGTATTCAGTTGCAGTGGACGAGGTGCATCTAAAGGATCTTCTGCTTGAACATGCGCCTCCACCTCCGGCAATAGCAGAATTT---GCAATTGCAAATTTGATCAAGATGGGTTTCCCA
TRN  10010101100011000
//