EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04048 - Sec8_exocyst)
FAM  PF04048
PID  Sec8_exocyst
DES  Sec8 exocyst complex component specific domain
IPR  IPR007191
ANO  6
ALN  170
AID  0.232171
APH  ((((SEC8_YEAST/28-175:1.29831,SEC8_SCHPO/35-191:1.24843):0.27015,SEC8_NEUCR/55-223:0.53713):0.89717,SEC8_CAEEL/4-153:0.76860):0.08905,SEC8_MOUSE/1-144:0.72883,SEC8_DROME/1-146:0.50727);
ATP  ((((SEC8_YEAST/28-175,SEC8_SCHPO/35-191),SEC8_NEUCR/55-223),SEC8_CAEEL/4-153),SEC8_MOUSE/1-144,SEC8_DROME/1-146);
ATL  6.34497
DNO  6
DLN  510
DID  0.372695
DPH  ((SEC8_NEUCR/55-223:0.47742,(SEC8_SCHPO/35-191:0.78995,SEC8_YEAST/28-175:0.74181):0.24844):0.30783,SEC8_CAEEL/4-153:0.76110,(SEC8_DROME/1-146:0.31411,SEC8_MOUSE/1-144:0.53006):0.06669);
DTP  ((SEC8_NEUCR/55-223,(SEC8_SCHPO/35-191,SEC8_YEAST/28-175)),SEC8_CAEEL/4-153,(SEC8_DROME/1-146,SEC8_MOUSE/1-144));
DTL  4.23741
RID  0.232171
RPH  ((((SEC8_YEAST/28-175:1.29831,SEC8_SCHPO/35-191:1.24843):0.27015,SEC8_NEUCR/55-223:0.53713):0.89717,SEC8_CAEEL/4-153:0.76860):0.08905,SEC8_MOUSE/1-144:0.72883,SEC8_DROME/1-146:0.50727);
RTP  ((((SEC8_YEAST/28-175,SEC8_SCHPO/35-191),SEC8_NEUCR/55-223),SEC8_CAEEL/4-153),SEC8_MOUSE/1-144,SEC8_DROME/1-146);
RTL  6.34497
LNK  SEC8_CAEEL/4-153:Q9XWS2:AL032631
LNK  SEC8_DROME/1-146:Q9VNH6:AE003601
LNK  SEC8_MOUSE/1-144:O35382:AF022962
LNK  SEC8_NEUCR/55-223:Q9HE88:AL451015
LNK  SEC8_SCHPO/35-191:O74562:AL031530
LNK  SEC8_YEAST/28-175:P32855:X64693
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SEC8_YEAST/28-175
ASQ  MNSSLDHLQNDLNRINLQWNR--------ILSDNTNP-------------LELALAFLDDTSVGLGHRYEEFNQLKSQIGSHLQDVVNEHSQVFNTNVASYGKAVSSIMQAQEQTLNLKNCLKEANEKITTDK-GSLQELNDNNLKYTKMIDVLVNIEELLQIPEKIEEN
DSQ  ATGAATAGTTCCCTGGACCATCTTCAGAATGACTTAAACAGGATAAATCTTCAATGGAATAGA------------------------ATACTGTCGGATAACACTAATCCC---------------------------------------TTAGAACTAGCGCTCGCATTTTTGGATGATACATCTGTAGGTCTGGGCCACCGGTATGAAGAATTCAATCAATTAAAGTCACAAATTGGTAGTCACTTACAAGATGTTGTTAATGAACATAGCCAAGTGTTCAACACTAATGTGGCTTCTTACGGAAAAGCAGTCAGTTCGATCATGCAGGCCCAAGAACAGACTTTAAATCTGAAAAATTGTTTAAAGGAAGCTAATGAGAAAATCACCACTGATAAA---GGTTCTTTACAGGAATTAAATGATAATAACTTGAAGTATACAAAAATGATTGATGTTTTAGTCAATATTGAGGAGTTATTACAGATACCCGAAAAAATTGAGGAGAAC
TRN  10010101100011000
NAM  SEC8_NEUCR/55-223
ASQ  RNAPPPRSAQRGRTGAGDMQIQSNAERQIGNVLDLIKREWPAMVETDCIPVQLALQLLDTSSVGRAHEYRNFQQTHQFLQESLKNIVHDHHQGFNSSIGTFHKIQGSIQSSQKKVRALKESLAASKTALCTTN-PELKQLHATSRMYDGVLQTLNELDDLRTVPDQLEAR
DSQ  CGAAATGCGCCCCCGCCCCGGTCTGCCCAGCGTGGCCGCACGGGTGCCGGCGATATGCAGATCCAGTCCAATGCCGAGCGCCAGATTGGAAACGTGCTGGATCTGATCAAGAGAGAATGGCCCGCCATGGTCGAGACAGACTGCATCCCCGTCCAGCTGGCTCTACAGCTTCTCGACACCAGCTCCGTCGGCCGCGCCCACGAATACCGCAACTTCCAGCAGACACACCAGTTCCTCCAAGAGTCCCTCAAGAACATTGTCCACGACCACCACCAAGGCTTCAACAGTTCCATTGGTACATTCCACAAGATCCAAGGGAGCATACAGTCCTCCCAGAAGAAGGTGCGCGCCCTCAAGGAGTCGCTGGCAGCCTCCAAGACGGCACTCTGCACCACCAAT---CCCGAACTCAAACAGCTACATGCCACGTCACGCATGTACGATGGCGTCCTACAAACACTGAACGAGCTCGATGACTTGCGCACCGTTCCAGACCAGTTGGAGGCCAGG
TRN  10010101100011001
NAM  SEC8_SCHPO/35-191
ASQ  DNELSSEYASRGMHIGDLENLVN---EIEDEWKDLGREDYQP----------ISTALELLDDSSFGRDYKSFLNVYDRISAALQTIAHTHKDDFTRGISAYGEIMEGIQKCNSRIIALKQSLEASQECIGNTNSKELQQTLARSSQYKKVISVLKELNEANQLFDNFHTL
DSQ  GACAATGAATTGAGTTCAGAGTATGCATCGCGTGGAATGCACATAGGCGATTTAGAAAATTTAGTAAAT---------GAAATTGAGGATGAATGGAAAGACCTGGGAAGAGAAGACTATCAACCG------------------------------ATATCTACAGCGTTGGAACTATTAGATGACAGTAGCTTTGGAAGAGATTATAAGTCTTTTCTGAACGTTTACGATCGAATTAGTGCTGCATTACAAACGATTGCCCATACTCATAAAGATGACTTTACTCGAGGTATATCGGCTTATGGAGAAATAATGGAGGGAATTCAGAAGTGCAATTCGAGAATCATAGCATTAAAGCAATCCCTTGAGGCTTCGCAAGAATGCATTGGTAATACTAATAGCAAAGAGCTTCAACAAACATTGGCTCGTAGTTCTCAATACAAAAAAGTCATAAGTGTGCTCAAGGAACTTAATGAAGCCAACCAGCTGTTTGACAACTTTCATACGCTT
TRN  10010101100011000
NAM  SEC8_CAEEL/4-153
ASQ  NGATPVAAARRHRPLPAERATSNSNE--TGLLINVIR----------------SLTSSVSEDQ-REVEKSRLEKGYKESGALIDRLVKNHQQDVEKCLVSFRDVSSKISNCRERIHNVRNALHTVKSLLELRR-DDLKKLWHENAQQKSVCEIMAKLEELREAPSKIENL
DSQ  AACGGGGCTACTCCGGTGGCGGCCGCTAGAAGGCATCGACCATTGCCTGCAGAGAGAGCAACATCGAACTCAAACGAA------ACGGGTCTTTTAATAAATGTAATCCGA------------------------------------------------TCACTAACATCGTCAGTTTCGGAAGATCAA---CGAGAAGTAGAGAAATCGAGATTAGAAAAAGGATATAAAGAATCTGGAGCACTAATCGATCGTTTAGTTAAAAATCATCAACAAGACGTCGAAAAATGTTTAGTTTCATTTCGAGATGTTTCTTCAAAAATATCAAATTGTCGAGAACGTATTCACAATGTTCGGAATGCCCTACACACAGTCAAAAGCTTATTGGAATTACGGAGG---GATGACCTGAAAAAGCTGTGGCACGAGAATGCACAGCAAAAATCAGTTTGCGAGATTATGGCAAAATTAGAAGAACTTCGAGAAGCTCCATCAAAAATCGAGAATCTA
TRN  10010101100011000
NAM  SEC8_DROME/1-146
ASQ  MDAPPPTKPPRGVKYGKDESAGC------GFLVNVIK----------------SLGFSETTEE-RQKEKQKIEAEFKRSDLRLNELVSRHDQQLTQVLPLFSQVSSEVTASRERIHAVKENLGVCKRLLQCRR-DELRKMWMDAVQHKYVLEMLEQIQELRKVPQRVVGY
DSQ  ATGGACGCCCCACCGCCCACGAAGCCCCCTAGGGGTGTGAAGTACGGCAAGGATGAGTCCGCAGGATGT------------------GGCTTCCTGGTCAACGTCATCAAG------------------------------------------------TCCCTGGGATTCAGCGAGACCACCGAGGAG---CGCCAGAAGGAGAAGCAGAAGATCGAGGCGGAATTCAAGCGCTCGGATCTGCGCTTGAACGAGCTGGTCTCGCGGCACGACCAGCAGCTTACCCAGGTGCTGCCCCTGTTCAGCCAGGTGTCCTCGGAGGTGACGGCCAGCCGGGAGCGGATTCATGCAGTCAAGGAGAACCTTGGTGTCTGCAAGCGGCTGCTGCAGTGCCGGCGC---GATGAGCTCCGGAAGATGTGGATGGATGCGGTGCAGCACAAGTACGTTCTGGAGATGCTGGAGCAAATCCAGGAGCTGCGCAAAGTGCCTCAAAGGGTGGTGGGCTAC
TRN  10010101100011011
NAM  SEC8_MOUSE/1-144
ASQ  MAAEAAGGKYRSTVSKSKDPS--------GLLISVIR----------------TLSTSDDVED-RENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKR-DELRKLWIEGIEHKHVLNLLDEIENIKQVPQKLEQC
DSQ  ATGGCGGCAGAAGCAGCTGGTGGGAAATACAGGAGCACAGTCAGCAAAAGCAAAGACCCCTCG------------------------GGGCTGCTCATCTCGGTGATCAGG------------------------------------------------ACTCTGTCTACCAGTGATGATGTTGAAGAC---CGAGAAAATGAGAAAGGTCGCCTTGAAGAAGCCTATGAGAAGTGTGACCGTGACCTGGATGAATTGATCGTTCAGCACTACACAGAATTGACCACAGCCATTCGCACATACCAGAGTATCACAGAACGCATCACTAACTCGAGGAATAAAATCAAGCAGGTCAAAGAGAATCTGCTTTCCTGCAAGATGCTGCTGCATTGCAAACGG---GATGAGCTTCGTAAGCTGTGGATTGAAGGAATCGAGCATAAGCACGTCCTGAACCTACTGGATGAGATTGAGAACATCAAGCAAGTGCCTCAAAAGCTGGAACAGTGC
TRN  10010101100011011
//