EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03982 - DAGAT)
FAM  PF03982
PID  DAGAT
DES  Diacylglycerol acyltransferase
IPR  IPR007130
ANO  10
ALN  316
AID  0.415751
APH  (((((Q23067_CAEEL/63-359:0.44433,(O01881_CAEEL/55-349:0.34424,(Q9N4S3_CAEEL/44-340:0.24945,Q9XUW0_CAEEL/50-345:0.34609):0.11384):0.14584):0.12905,(Q9H630_HUMAN/39-264:0.52313,Q9DCL0_MOUSE/40-335:0.37398):0.14880):0.04203,Q9DCV3_MOUSE/92-388:0.45587):0.21622,Q9ASU1_ARATH/39-312:0.98699):0.49199,Q9V4R3_DROME/42-352:0.13788,Q9V4R4_DROME/42-352:0.13107);
ATP  (((((Q23067_CAEEL/63-359,(O01881_CAEEL/55-349,(Q9N4S3_CAEEL/44-340,Q9XUW0_CAEEL/50-345))),(Q9H630_HUMAN/39-264,Q9DCL0_MOUSE/40-335)),Q9DCV3_MOUSE/92-388),Q9ASU1_ARATH/39-312),Q9V4R3_DROME/42-352,Q9V4R4_DROME/42-352);
ATL  5.30245
DNO  10
DLN  948
DID  0.488059
DPH  (((Q23067_CAEEL/63-359:0.37846,(O01881_CAEEL/55-349:0.33966,(Q9N4S3_CAEEL/44-340:0.25071,Q9XUW0_CAEEL/50-345:0.30193):0.08443):0.09243):0.14756,((Q9ASU1_ARATH/39-312:0.72431,(Q9H630_HUMAN/39-264:0.43178,Q9DCL0_MOUSE/40-335:0.30730):0.04258):0.08667,Q9DCV3_MOUSE/92-388:0.33528):0.03996):0.37757,Q9V4R3_DROME/42-352:0.13405,Q9V4R4_DROME/42-352:0.16628);
DTP  (((Q23067_CAEEL/63-359,(O01881_CAEEL/55-349,(Q9N4S3_CAEEL/44-340,Q9XUW0_CAEEL/50-345))),((Q9ASU1_ARATH/39-312,(Q9H630_HUMAN/39-264,Q9DCL0_MOUSE/40-335)),Q9DCV3_MOUSE/92-388)),Q9V4R3_DROME/42-352,Q9V4R4_DROME/42-352);
DTL  4.24096
RID  0.415751
RPH  (((((Q23067_CAEEL/63-359:0.44433,(O01881_CAEEL/55-349:0.34424,(Q9N4S3_CAEEL/44-340:0.24945,Q9XUW0_CAEEL/50-345:0.34609):0.11384):0.14584):0.12905,(Q9H630_HUMAN/39-264:0.52313,Q9DCL0_MOUSE/40-335:0.37398):0.14880):0.04203,Q9DCV3_MOUSE/92-388:0.45587):0.21622,Q9ASU1_ARATH/39-312:0.98699):0.49199,Q9V4R3_DROME/42-352:0.13788,Q9V4R4_DROME/42-352:0.13107);
RTP  (((((Q23067_CAEEL/63-359,(O01881_CAEEL/55-349,(Q9N4S3_CAEEL/44-340,Q9XUW0_CAEEL/50-345))),(Q9H630_HUMAN/39-264,Q9DCL0_MOUSE/40-335)),Q9DCV3_MOUSE/92-388),Q9ASU1_ARATH/39-312),Q9V4R3_DROME/42-352,Q9V4R4_DROME/42-352);
RTL  5.30245
LNK  O01881_CAEEL/55-349:O01881:AF003384
LNK  Q23067_CAEEL/63-359:Q23067:U64852
LNK  Q9ASU1_ARATH/39-312:Q9ASU1:AF361832
LNK  Q9DCL0_MOUSE/40-335:Q9DCL0:AK002693
LNK  Q9DCV3_MOUSE/92-388:Q9DCV3:AK002443
LNK  Q9H630_HUMAN/39-264:Q9H630:AK026297
LNK  Q9N4S3_CAEEL/44-340:Q9N4S3:AC006804
LNK  Q9V4R3_DROME/42-352:Q9V4R3:AE003840
LNK  Q9V4R4_DROME/42-352:Q9V4R4:AE003840
LNK  Q9XUW0_CAEEL/50-345:Q9XUW0:Z81557
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9V4R4_DROME/42-352
ASQ  SLIYGGLLVRSLMVTYLAYVFVHHKKTQSVVDGNGWMITRTNLLHRHYRDYFPVEL-VKTAE-LPATKNYILASFPHGILGTGIGINMGLEISKWLELFPQVRPKLGTLD--QHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTSNAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRRFQDFVKKLTGVSPLIPVGRGFFN-YTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQVIESLEKLFDQYKDKYLENSKSATLVVH
DSQ  TCACTGATCTACGGAGGTCTTTTGGTGCGTAGTCTGATGGTAACTTACTTGGCCTACGTCTTTGTGCACCACAAGAAAACCCAATCCGTTGTGGATGGCAATGGCTGGATGATAACACGCACCAACCTTTTGCATCGCCACTATCGTGATTACTTTCCCGTGGAGCTG---GTGAAAACAGCCGAA---CTGCCAGCTACTAAGAACTACATCTTGGCCAGCTTTCCCCACGGAATTCTGGGCACAGGCATTGGCATTAACATGGGCTTGGAAATCTCCAAGTGGCTGGAGCTATTCCCCCAAGTGCGTCCCAAACTGGGCACTCTGGAT------CAGCATTTCCATGTTCCGTTCATGCGTGAGGTCCTCCGCTGCTGGGGTCTGGTGTCAGTGTCCAAAGAGGCGCTGATCCGTATGCTCAGCAAGTCAAATGATCCCAAGCACAAGGATAATCGGGATGGTTTCACCTCCAATGCGGTGGCCATTCTGGTTGGCGGTGCCCAGGAAGCCATGGACTCTCATCCTGGGCAGTACATTTTAACCTTGAAGAATAGGAAAGGCTTCGTGCGAATGGCCATTAGAACGGGCTCATCGATTGTTCCTTCATTTTCCTTTGGAGAGGTGGACATTTTCGATCAGGTGGCAAATCCCCCCAACTCGCTGCTCCGACGGTTTCAGGACTTTGTCAAGAAGCTCACCGGAGTCTCTCCGCTGATTCCTGTGGGCCGCGGATTCTTCAAC---TACACCTTTGGCTTCCTCCCATTCCGACGACGCATTGTCCAAGTTGTTGGTGCTCCCATCGATGTTGTTAAGAACGAGCACCCAGACTCGGAGTATGTGGATAAAGTGCATGGACAGGTCATTGAGTCGCTGGAGAAGTTATTCGATCAGTACAAAGACAAGTACTTGGAGAATTCGAAGAGTGCCACTCTAGTTGTACAC
TRN  10010101100011000
NAM  Q9V4R3_DROME/42-352
ASQ  VLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQL-VKTAE-LPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLD--QNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFN-YSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLIIH
DSQ  GTGCTGTTCTATGGAAGCCTTTTGTGGCGCACCATTATGGTCATCTATTTGGTCTACGTCTACGCGAATCACAAGAGAACCCACTCCATTATGGATGGCAATGGCTGGAAAATTAACCGCAACAATTGGCTGTTTCGGCATTATCGGGACTACTTTCCCGTACAGCTG---GTCAAGACCGCAGAG---CTGCCGCCGAATAAGAACTACATTTTGGCCAGTTTTCCGCACGGAATTTTGGGGACTGGCATTTCCATTAATATGGGTCTAGACATCTCCAAGTGGCTGCAACTGTTCCCACAGGTGAGGCCCAAGGTGGCCACTTTGGAT------CAAAACTTCCTGACGCCCATCGTGCGTGGTCTCCTGAGATCTTGGGGCCTGGTGTCGGTTTCCAAGGAGGCCTTAGTATATCTGCTAACCAAATCAAACGATCCCAAGCACAAGGACAATCGTGATGGGTTCACCTCCAACGCGGTGGCTATTCTGGTGGGTGGTGCCCAGGAGGCACTAGACTCGCACCCTGGCAAATATATATTGACACTGAAGAACCGCAAGGGATTCGTTAAAATGGCCATTAGGACAGGGTCTTCGATTGTTCCCACGTTTTCCTTTGGCGAGGTGGACATTCTGGATCAGGTTGCCAATCCACCGAACTCTCGGGTTCGTCGCTTTCAAGACTTTGTAAAGAGGATAACGGGGATATCTCCGCTGATTCCCGTTGGCCGGGGCATCTTCAAC---TACTCCTTTGGCTTTCTGCCCAACCGTCGACGCATTGTCCAAGTTGTTGGCGCTCCCATCGACGTGGTTCAGAGCGATCAACCAGACGCAGCCTATGTGGATAAGATACACAAACAGGTTATTGACGACCTGGAGAAGATGTTCGCCAAGTACAAGGATCAGTACATACCGAACTCCAAGCAGGACAAGCTGATTATACAC
TRN  10010101100011000
NAM  Q9XUW0_CAEEL/50-345
ASQ  FVLFFTGQW-IILGLYAVWYLYDRESPR--RGGYRDNWFRNLSLHKWFAEYFPVKL-HKTAE-LDPNQNYLFGYHPHGILGVGAWSCFGFDACNVKQVFKGIRFNICTLP--GNFTAMFRREILLSIGMIESSKESIEHVLNSEEK-----------GRAVVIVVGGAAEALEAHPGKHTLTLANRKGFVREAVKTGAHLVPVYAFGENDIYKQIDNPEGSKLRKIQEWGKKKMGISLPLIYGRGYFQ-MALGLLPMSRAVNVVVGAPIQVEKELDPSKEVIDEIHGVYMEKLAELFEEHKAKFG-VSKDTRLVFQ
DSQ  TTTGTGCTCTTTTTCACCGGCCAGTGG---ATTATTTTGGGTCTCTACGCAGTTTGGTACCTTTACGATCGAGAATCTCCGAGA------AGAGGAGGATATCGGGATAATTGGTTCAGAAATTTGTCGCTGCACAAGTGGTTCGCCGAGTATTTTCCTGTTAAACTT---CACAAAACTGCGGAG---TTGGATCCAAACCAAAATTATTTATTCGGATATCATCCTCATGGAATTCTCGGTGTCGGAGCGTGGTCTTGTTTTGGATTTGATGCGTGCAATGTGAAGCAAGTGTTCAAAGGCATCCGCTTCAACATCTGCACCTTGCCC------GGCAACTTCACCGCAATGTTCCGCCGCGAGATCCTCCTCAGCATCGGTATGATCGAGAGCTCCAAAGAATCCATCGAGCACGTGCTCAACTCCGAGGAAAAG---------------------------------GGCCGTGCCGTTGTAATTGTCGTGGGTGGAGCCGCTGAAGCTCTTGAAGCTCACCCAGGGAAGCATACTCTAACACTGGCAAATCGCAAAGGTTTCGTGAGAGAAGCCGTGAAGACCGGAGCTCATCTGGTGCCAGTTTATGCGTTTGGAGAGAATGACATATATAAGCAAATTGACAACCCGGAAGGCTCGAAATTACGGAAAATTCAAGAATGGGGAAAGAAGAAAATGGGAATTTCACTGCCACTAATCTACGGAAGAGGATATTTTCAA---ATGGCTCTTGGGCTTCTTCCAATGAGCCGAGCTGTGAATGTAGTTGTCGGAGCGCCTATTCAAGTGGAAAAAGAGCTCGATCCTTCTAAGGAAGTCATTGATGAAATTCATGGAGTTTATATGGAAAAGCTCGCCGAGTTATTTGAAGAGCACAAGGCAAAGTTCGGA---GTTTCCAAGGACACTCGGCTCGTTTTTCAG
TRN  10010101100011000
NAM  Q9N4S3_CAEEL/44-340
ASQ  FFLLFTFQW-HILALYACWYFYDMDSPR--RGGYSSDWVRKWRVNDWFAQYFPINL-HKTAE-LSTDKNYLVGIHPHGIISMAAWSNFATNGTGIYEKFPGIRWNLCTLA--LQFRMAIRRELLLLTGLIDCSRESIEYVLDKCGQ----------KGRAVVLVIGGAEEALDAHPGYHTLTLASRKGFVREALITGAYLVPVYSFGENDVFEQMENPVGSRLRNFQEWCKSIFGISYPIFHGRGFFQ-LTFGYLPFRKPIDTVVGAPIPVEKVENPTKEQIDELHTIYCQKLTELFDEHKEKYG-VEKDVPLVLR
DSQ  TTTTTCTTGCTTTTCACTTTCCAATGG---CACATTTTGGCTCTCTACGCTTGCTGGTACTTCTACGATATGGATTCTCCGAGG------AGAGGTGGATATTCCAGTGATTGGGTCAGAAAATGGCGTGTCAACGACTGGTTCGCCCAATACTTCCCAATCAACTTG---CACAAAACTGCCGAA---CTCTCCACGGACAAGAACTATCTGGTTGGAATCCATCCTCATGGTATCATCTCCATGGCTGCATGGTCTAATTTTGCCACCAATGGAACGGGAATCTATGAGAAATTCCCTGGAATTCGCTGGAATTTGTGCACTTTAGCA------CTTCAGTTCAGAATGGCCATCCGTCGTGAGCTTCTCCTTCTCACCGGCCTAATCGACTGCTCCAGAGAATCCATTGAATATGTGCTTGACAAATGTGGCCAG------------------------------AAGGGACGTGCAGTGGTATTGGTGATTGGAGGAGCCGAAGAAGCTTTAGATGCTCATCCAGGCTACCACACACTCACTTTGGCATCAAGAAAGGGATTTGTTCGGGAGGCTTTGATTACTGGTGCCTACTTGGTCCCGGTGTATTCTTTTGGAGAGAATGACGTTTTTGAACAGATGGAGAATCCAGTTGGCTCACGGCTCCGCAACTTCCAAGAATGGTGCAAAAGCATTTTCGGCATCTCATATCCAATTTTCCATGGTCGTGGCTTCTTCCAA---CTAACTTTCGGATATCTTCCATTCCGTAAACCAATCGATACCGTAGTCGGAGCCCCAATTCCCGTTGAAAAAGTGGAAAATCCGACGAAAGAGCAAATCGACGAGCTTCACACCATTTATTGTCAAAAGTTGACGGAGCTGTTCGATGAGCACAAGGAAAAATATGGA---GTGGAGAAGGACGTGCCGTTGGTGCTCCGG
TRN  10010101100011000
NAM  O01881_CAEEL/55-349
ASQ  YMLY-TVLW-PLIFLYGLWMIYDWNSPK--KGAYMSNWFQRQRIHSWYANYFPVKL-HTTSD-MPEEHNYLIGYHPHGIISMAAFINFATNGTGILDTLPRIRFHLCTLV--GQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKK-----------GKAVVLVVGGAEEALDAHPGCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQAENPKGSTIRQFQTIMKRVLGFSPPAFYGRGVFN-YTFGLLPFRKPINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELFEEHKTKYD-VSPTTQLVIN
DSQ  TACATGTTATAT---ACCGTACTCTGG---CCTTTGATCTTTCTGTATGGGCTTTGGATGATTTACGATTGGAATTCACCAAAG------AAGGGAGCCTATATGAGCAATTGGTTCCAGAGACAAAGAATTCATTCGTGGTATGCCAACTATTTTCCAGTCAAATTG---CACACAACATCTGAC---ATGCCAGAAGAACATAACTATTTGATTGGGTACCATCCGCATGGAATAATTTCAATGGCCGCATTCATCAACTTTGCAACAAATGGAACTGGAATTCTCGATACTCTTCCACGAATTCGTTTCCATTTGTGCACACTTGTT------GGTCAATTCTGGACTCCGTGGAGACGTGAGTGGGGATTGTTGCACGGAATGATAGACTGCAGTCGAGAAAGCATCAAGCACGTTTTGGAGCATGAAAAGAAA---------------------------------GGAAAAGCAGTTGTATTGGTGGTTGGTGGAGCTGAAGAAGCACTTGATGCACATCCAGGATGCCATATTTTGACTTTGAAAAAAAGGAAAGGATTCGTGAAAATTGCCCTGCAAACTGGAGCTCAACTGGTTCCATGCTATTCATTCGGTGAAAATGATATTTTCAATCAAGCCGAAAATCCAAAGGGATCAACAATTCGACAGTTCCAAACGATAATGAAAAGAGTCTTGGGATTCTCCCCTCCAGCATTCTATGGGAGAGGAGTATTCAAC---TATACATTTGGTCTTCTTCCATTCAGAAAACCTATCAACACTGTTCTCGGCGCTCCAATTTCAGTGACAAAGACAGTGAATCCAACTCAAGAACAAATCGACACACTTCATCAGACATACATGGACCGTCTTCATGAGCTTTTCGAGGAGCACAAGACAAAATACGAT---GTCTCTCCAACTACACAACTTGTTATCAAT
TRN  10010101100011000
NAM  Q23067_CAEEL/63-359
ASQ  HVLFNTRWW-FLVPLYAVWFYYDFDTPK--KASRRWNWARRHVAWKYFASYFPLRL-IKTAD-LPADRNYIIGSHPHGMFSVGGFTAMSTNATGFEDKFPGIKSHIMTLN--GQFYFPFRREFGIMLGGIEVSKESLEYTLTKCGK-----------GRACAIVIGGASEALEAHPNKNTLTLINRRGFCKYALKFGADLVPMYNFGENDLYEQYENPKGSRLREVQEKIKDMFGLCPPLLRGRSLFNQYLIGLLPFRKPVTTVMGRPIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHS-IPPDTHLIFQ
DSQ  CACGTCTTGTTCAATACTCGATGGTGG---TTCCTTGTTCCACTCTACGCTGTCTGGTTCTACTATGATTTTGATACACCGAAA------AAAGCTTCAAGAAGATGGAATTGGGCCAGAAGACACGTAGCCTGGAAGTACTTTGCCAGCTACTTCCCATTGAGATTG---ATCAAGACTGCTGAC---CTTCCGGCGGATCGTAATTACATCATTGGCTCTCATCCTCATGGAATGTTCTCGGTTGGTGGTTTTACTGCAATGAGCACCAACGCGACCGGATTTGAAGACAAGTTCCCGGGAATAAAATCTCACATCATGACGCTAAAT------GGGCAATTTTATTTCCCATTTCGTCGAGAATTCGGAATAATGCTCGGTGGAATCGAAGTTTCGAAAGAATCACTTGAATACACTCTAACTAAATGTGGAAAA---------------------------------GGACGAGCATGCGCAATTGTCATTGGCGGAGCCTCGGAGGCTCTTGAAGCTCATCCCAATAAAAATACATTGACGTTGATCAATCGACGTGGTTTCTGCAAATATGCTCTGAAGTTTGGAGCAGACCTCGTACCAATGTACAATTTCGGAGAGAATGATTTATACGAGCAGTATGAAAACCCGAAGGGATCTAGATTGCGAGAAGTTCAGGAGAAAATCAAGGACATGTTCGGATTGTGTCCCCCATTGCTCCGCGGTCGATCGTTGTTCAACCAATACCTTATCGGATTGCTGCCGTTCCGAAAACCAGTTACAACAGTCATGGGAAGGCCAATTCGAGTCACCCAAACCGACGAGCCAACCGTTGAGCAGATTGATGAGCTGCATGCAAAATATTGTGATGCTCTCTACAATCTGTTCGAGGAGTACAAGCATCTTCACTCC---ATTCCTCCCGACACTCATCTCATCTTCCAG
TRN  10010101100011000
NAM  Q9DCL0_MOUSE/40-335
ASQ  VMLVLYNYW-FLYIPYLVWFYYDWRTPE--QGGRRWNWVQSWPVWKYFFLYFPICL-VKTQD-LDPGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAK--IWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGG-----------GNVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWLRTIQDAMYDSMGVALPLIYARGIFQ-HYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQTYLEELKKLFNEHKGKYG-IPEHETLVFK
DSQ  GTGATGCTGGTCCTGTACAACTATTGG---TTCCTTTACATCCCATATCTGGTCTGGTTTTACTATGACTGGAGAACCCCAGAG------CAAGGAGGCAGAAGATGGAACTGGGTCCAAAGCTGGCCTGTGTGGAAGTATTTTTTTCTGTATTTTCCAATCTGTCTT---GTCAAAACGCAAGAT---TTGGATCCGGGTCACAATTATATATTTGGATTTCACCCTCATGGAATATTCGTGCCTGGAGCCTTTGGAAATTTTTGTACAAAATACTCAGACTTCAAGAAGCTATTTCCTGGCTTTACATCGTATCTCCACGTGGCCAAG------ATCTGGTTCTGTTTCCCGTTGTTCCGAGAATATCTGATGAGTAACGGGCCGGTTTCAGTGTCTAAGGAGAGTTTGTCTCATGTGCTGAGCAAGGATGGAGGT---------------------------------GGCAATGTCTCAATCATTGTCCTCGGAGGTGCAAAGGAGGCGCTGGAGGCTCACCCAGGAACATTCACCCTGTGCATCCGCCAGCGCAAAGGGTTTGTTAAGATGGCCTTGACCCATGGTGCCAGTTTGGTTCCAGTATTTTCTTTTGGTGAAAATGATCTATATAAGCAAATTAACAACCCCAAAGGCTCCTGGCTACGAACTATACAAGACGCAATGTATGATTCAATGGGAGTAGCCTTGCCACTGATATATGCCAGAGGAATTTTCCAG---CACTACTTTGGCATAATGCCCTATCGGAAGCTGATCTACACTGTTGTTGGCCGCCCCATCCCTGTTCAGCAGACTCTGAACCCGACCTCAGAGCAGATTGAAGAGCTGCATCAGACATACCTAGAGGAGCTAAAGAAACTGTTCAATGAACACAAAGGGAAATATGGG---ATTCCGGAGCACGAAACTCTGGTATTTAAA
TRN  10010101100011001
NAM  Q9DCV3_MOUSE/92-388
ASQ  MYTFCTDCW-LIAVLYFTWLAFDWNTPK--KGGRRSQWVRNWAVWRYFRDYFPIQL-VKTHN-LLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLA--GNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGS-----------GNAIIIVVGGAAESLSSMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFG-LPETEVLEVN
DSQ  ATGTACACCTTCTGCACAGACTGCTGG---CTGATAGCTGTGCTCTACTTCACCTGGCTGGCATTTGACTGGAACACGCCCAAG------AAAGGTGGCAGGAGATCGCAGTGGGTGCGAAACTGGGCCGTGTGGCGCTACTTCCGAGACTACTTTCCCATCCAGCTG---GTGAAGACACACAAC---CTGCTGACCACCAGGAACTATATCTTTGGATACCACCCCCATGGCATCATGGGCCTGGGTGCCTTCTGTAACTTCAGCACAGAGGCTACTGAAGTCAGCAAGAAGTTTCCTGGCATAAGGCCCTATTTGGCTACGTTGGCT------GGTAACTTCCGGATGCCTGTGCTTCGCGAGTACCTGATGTCTGGAGGCATCTGCCCTGTCAACCGAGACACCATAGACTACTTGCTCTCCAAGAATGGGAGT---------------------------------GGCAATGCTATCATCATCGTGGTGGGAGGTGCAGCTGAGTCCCTGAGCTCCATGCCTGGCAAGAACGCAGTCACCCTGAAGAACCGCAAAGGCTTTGTGAAGCTGGCCCTGCGCCATGGAGCTGATCTGGTTCCCACTTATTCCTTTGGAGAGAATGAGGTATACAAGCAGGTGATCTTTGAGGAGGGTTCCTGGGGCCGATGGGTCCAGAAGAAGTTCCAGAAGTATATTGGTTTCGCCCCCTGCATCTTCCATGGCCGAGGCCTCTTCTCCTCTGACACCTGGGGGCTGGTGCCCTACTCCAAGCCCATCACCACCGTCGTGGGGGAGCCCATCACTGTCCCCAAGCTGGAGCACCCGACCCAGAAAGACATCGACCTGTACCATGCCATGTACATGGAGGCCCTGGTGAAGCTCTTTGACAATCACAAGACCAAATTTGGC---CTTCCAGAGACTGAGGTGCTGGAGGTGAAC
TRN  10010101100011011
NAM  Q9H630_HUMAN/39-264
ASQ  IALLFTRFW-LLTVLYAAWWYLDRDKPR--QGGRHIQAIRCWTIWKYMKDYFPISL-VKTAE-LDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMPT--LWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGG-----------GNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHG----------------------------YQASGKSTLGSV-------GNWQGFYFG------------------GKMAETNADSI----------LVEIF-------S--PFTIKIIFW
DSQ  ATAGCCCTCCTGTTTACAAGATTCTGG---CTCCTCACTGTCCTGTATGCGGCCTGGTGGTATCTGGACCGAGACAAGCCACGG------CAGGGGGGCCGGCACATCCAGGCCATCAGGTGCTGGACTATATGGAAGTACATGAAGGACTATTTCCCCATCTCGCTG---GTCAAGACTGCTGAG---CTGGACCCCTCTCGGAACTACATTGCGGGCTTCCACCCCCATGGAGTCCTGGCAGTCGGAGCCTTTGCCAACCTGTGCACTGAGAGCACAGGCTTCTCTTCGATCTTCCCCGGTATCCGCCCCCATCTGATGATGCCGACC------TTGTGGTTCCGGGCCCCCTTCTTCAGAGATTACATCATGTCTGCAGGGTTGGTCACATCAGAAAAGGAGAGTGCTGCTCACATTCTGAACAGGAAGGGTGGC---------------------------------GGAAACTTGCTGGGCATCATTGTAGGGGGTGCCCAGGAGGCCCTGGATGCCAGGCCTGGATCCTTCACGCTGTTACTGCGGAACCGAAAGGGCTTCGTCAGGCTCGCCCTGACACACGGG------------------------------------------------------------------------------------TATCAAGCCTCTGGGAAGAGCACTCTGGGTTCAGTT---------------------GGCAATTGGCAAGGATTTTATTTTGGT------------------------------------------------------GGGAAGATGGCAGAGACGAATGCAGATTCTATT------------------------------TTGGTAGAGATTTTC---------------------AGT------CCATTCACAATTAAGATTATATTTTGG
TRN  10010101100011000
NAM  Q9ASU1_ARATH/39-312
ASQ  SLIFLPPSL-SLMVLGLLSLFIFIPIDH--RSKYGRKLAR--YICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGV-VALC-DLTGFMPI-----PNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYS--------------CVLVPGGVQETFHMQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYL-----KLSRAIRFTPICFWG--VFGSP----LPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVG-----YDLELK
DSQ  TCTCTCATTTTCCTTCCTCCTTCTCTA---TCTCTCATGGTCTTGGGCTTGCTCTCTCTGTTTATCTTTATCCCAATCGATCAT------CGTAGCAAATATGGTCGTAAGCTCGCTAGG------TACATATGCAAGCACGCGTGTAATTATTTCCCCGTCTCTCTGTACGTCGAGGATTACGAAGCTTTCCAGCCTAATCGTGCCTATGTCTTTGGTTATGAACCACATTCGGTGCTACCGATTGGAGTT---GTTGCTCTTTGT---GATCTCACAGGGTTTATGCCTATT---------------CCTAACATTAAAGTTCTTGCAAGTAGTGCTATATTCTACACTCCCTTTCTAAGGCATATATGGACATGGTTAGGGCTCACCGCTGCTTCTAGGAAGAATTTCACTTCCCTTTTGGATTCTGGCTACAGT------------------------------------------TGTGTTCTTGTACCTGGTGGTGTGCAGGAGACTTTTCATATGCAACATGATGCTGAGAATGTCTTCCTTTCAAGGAGAAGAGGATTTGTGCGCATAGCCATGGAACAGGGGAGCCCTCTGGTTCCAGTATTCTGCTTTGGTCAGGCACGCGTGTACAAATGGTGGAAGCCGGATTGTGATCTCTATCTT---------------AAACTATCTAGAGCAATCAGATTCACCCCGATCTGCTTCTGGGGA------GTTTTTGGATCACCA------------TTACCGTGTCGACAGCCTATGCATGTGGTCGTTGGTAAACCAATAGAAGTCACAAAAACTCTGAAGCCAACTGACGAAGAGATTGCTAAGTTTCATGGCCAGTATGTGGAAGCGCTTAGGGATCTGTTTGAGAGGCACAAGTCCCGAGTCGGC---------------TATGATCTTGAGCTGAAA
TRN  10010101100011000
//