EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03975 - CheD)
FAM  PF03975
PID  CheD
DES  CheD
IPR  IPR005659
ANO  10
ALN  130
AID  0.345454
APH  (Q9X005_THEMA/46-157:0.32630,O29224_ARCFU/47-157:0.64146,(((((Q9I6V8_PSEAE/66-184:0.38771,O51551_BORBU/55-163:0.96815):0.17611,Q9KKL4_VIBCH/92-216:0.64593):0.30878,O87719_CAUCR/58-168:0.52454):0.33249,(Q9HQW9_HALN1/1-109:0.85575,O58226_PYRHO/47-162:0.42272):0.17322):0.13095,(CHED_BACSU/52-166:0.45239,Q9KA57_BACHD/48-162:0.15095):0.26260):0.12297);
ATP  (Q9X005_THEMA/46-157,O29224_ARCFU/47-157,(((((Q9I6V8_PSEAE/66-184,O51551_BORBU/55-163),Q9KKL4_VIBCH/92-216),O87719_CAUCR/58-168),(Q9HQW9_HALN1/1-109,O58226_PYRHO/47-162)),(CHED_BACSU/52-166,Q9KA57_BACHD/48-162)));
ATL  6.88302
DNO  10
DLN  390
DID  0.43859
DPH  (((O58226_PYRHO/47-162:0.43652,((((Q9I6V8_PSEAE/66-184:0.33669,(Q9KKL4_VIBCH/92-216:0.46981,O51551_BORBU/55-163:0.60813):0.27623):0.16331,O87719_CAUCR/58-168:0.30594):0.18929,Q9HQW9_HALN1/1-109:0.40026):0.24022,O29224_ARCFU/47-157:0.35140):0.10973):0.04666,Q9X005_THEMA/46-157:0.28887):0.28113,CHED_BACSU/52-166:0.30899,Q9KA57_BACHD/48-162:0.23082);
DTP  (((O58226_PYRHO/47-162,((((Q9I6V8_PSEAE/66-184,(Q9KKL4_VIBCH/92-216,O51551_BORBU/55-163)),O87719_CAUCR/58-168),Q9HQW9_HALN1/1-109),O29224_ARCFU/47-157)),Q9X005_THEMA/46-157),CHED_BACSU/52-166,Q9KA57_BACHD/48-162);
DTL  5.04618
RID  0.345454
RPH  (Q9X005_THEMA/46-157:0.32630,O29224_ARCFU/47-157:0.64146,(((((Q9I6V8_PSEAE/66-184:0.38771,O51551_BORBU/55-163:0.96815):0.17611,Q9KKL4_VIBCH/92-216:0.64593):0.30878,O87719_CAUCR/58-168:0.52454):0.33249,(Q9HQW9_HALN1/1-109:0.85575,O58226_PYRHO/47-162:0.42272):0.17322):0.13095,(CHED_BACSU/52-166:0.45239,Q9KA57_BACHD/48-162:0.15095):0.26260):0.12297);
RTP  (Q9X005_THEMA/46-157,O29224_ARCFU/47-157,(((((Q9I6V8_PSEAE/66-184,O51551_BORBU/55-163),Q9KKL4_VIBCH/92-216),O87719_CAUCR/58-168),(Q9HQW9_HALN1/1-109,O58226_PYRHO/47-162)),(CHED_BACSU/52-166,Q9KA57_BACHD/48-162)));
RTL  6.88302
LNK  CHED_BACSU/52-166:P40404:M20144
LNK  O29224_ARCFU/47-157:O29224:AE001031
LNK  O51551_BORBU/55-163:O51551:AE001162
LNK  O58226_PYRHO/47-162:O58226:BA000001
LNK  O87719_CAUCR/58-168:O87719:AJ006687
LNK  Q9HQW9_HALN1/1-109:Q9HQW9:AE005033
LNK  Q9I6V8_PSEAE/66-184:Q9I6V8:AE004455
LNK  Q9KA57_BACHD/48-162:Q9KA57:BA000004
LNK  Q9KKL4_VIBCH/92-216:Q9KKL4:AE004434
LNK  Q9X005_THEMA/46-157:Q9X005:AE001755
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9X005_THEMA/46-157
ASQ  MLPDSGG----------KTDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFESKGM----NIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRKVGGGE----QLEIKEI
DSQ  ATGCTTCCAGACAGCGGAGGA------------------------------AAAACGGACAAACCCGGCAAATACGCAGACACGGCGGTAAAAACGCTGGTGGAAGAGTTGAAGAAAATGGGAGCAAAGGTGGAAAGACTGGAAGCGAAAATAGCGGGTGGAGCCAGTATGTTTGAATCTAAGGGGATG------------AACATAGGAGCGAGGAACGTAGAGGCTGTGAAAAAACATCTGAAGGATTTTGGAATCAAACTACTGGCAGAAGACACGGGGGGCAACAGAGCAAGGAGTGTTGAATACAATATTGAAACTGGAAAGCTTCTCGTGAGAAAAGTGGGTGGTGGTGAA------------CAATTAGAAATAAAAGAAATT
TRN  10010101100011010
NAM  Q9KA57_BACHD/48-162
ASQ  MLPDSALGK-------KQEFNRAKYADTALDLLLSKLEAIGAKRYSLKAKMAGGAQMFSFASNNDMMRIGQRNVEAVKKKLRELSIPILAEDVGGSNGRTIEFNPETKRLSIRTVHQG--------EKEI
DSQ  ATGCTTCCTGACTCCGCGTTAGGGAAA---------------------AAGCAGGAGTTTAATCGCGCAAAGTATGCCGATACGGCGCTAGACCTCTTGCTTTCGAAGCTTGAAGCGATTGGAGCCAAACGTTATTCATTAAAAGCAAAAATGGCCGGAGGAGCGCAAATGTTTTCCTTTGCCTCGAACAATGACATGATGCGGATCGGTCAACGAAATGTAGAAGCAGTAAAGAAAAAGTTGCGTGAGCTGAGCATTCCGATTTTAGCTGAGGATGTAGGGGGCTCGAACGGACGAACGATCGAATTTAACCCAGAGACCAAACGGCTTTCCATCCGGACCGTACATCAAGGA------------------------GAGAAGGAGATA
TRN  10010101100011000
NAM  CHED_BACSU/52-166
ASQ  MLPDSTLSK-------TAELNRAKYADTAVQTTIDMLIEAGCRKFALKAKLAGGSEMFKFKSTNDLMKIGPRNVLAIKEQLSLFNIPIISEDTGGSSGRTIEFEPKSCMLHIRTVKQG--------EKTI
DSQ  ATGCTTCCGGATTCGACGTTATCGAAA---------------------ACTGCCGAGCTCAACCGGGCTAAGTACGCTGACACCGCCGTACAGACCACGATTGATATGCTGATAGAAGCGGGATGCCGGAAATTTGCATTAAAAGCAAAGCTGGCCGGCGGATCAGAGATGTTTAAATTTAAATCGACAAATGATTTGATGAAGATCGGACCGAGAAATGTATTAGCGATAAAAGAACAGCTGTCTTTATTTAATATTCCTATTATTAGTGAAGATACGGGCGGCTCAAGCGGCCGGACGATAGAATTTGAACCGAAGTCCTGCATGCTGCATATTCGAACTGTTAAACAAGGT------------------------GAAAAAACGATT
TRN  10010101100011000
NAM  O58226_PYRHO/47-162
ASQ  LLPEAAR-Y-------GHRGNPAKYVDTGLQLLLKEVIKLGASKFRLEAKLFGGAQMFDNIRS-EELKIGEKNVQVAKRELRKLGIRLVAEDTGGKGGRTIYLDLSTGKVRMRKVTEGK-----VIEKVY
DSQ  TTACTCCCAGAAGCTGCTAGG---TAT---------------------GGACATAGAGGAAACCCAGCAAAATACGTCGATACTGGACTTCAATTGCTCCTAAAGGAGGTTATAAAGCTTGGAGCTTCAAAGTTCAGACTCGAAGCCAAGCTCTTTGGTGGAGCTCAAATGTTTGATAATATAAGGAGT---GAAGAGCTTAAAATTGGGGAGAAAAACGTTCAAGTCGCTAAGAGGGAATTGAGAAAGCTTGGAATAAGGCTTGTAGCCGAAGATACGGGTGGAAAGGGGGGTAGGACGATCTACTTAGATCTCTCGACTGGGAAAGTTAGAATGAGAAAGGTGACGGAGGGAAAG---------------GTAATAGAAAAGGTGTAC
TRN  10010101110011000
NAM  O29224_ARCFU/47-157
ASQ  MLPQSGN----------GTKRSAKYADHAVEMMTEAMERLGSDRKRIVAKMAGGAQIFKHMTM-DMLRIGDRNAEAIRTILRDYGIRIVSEDLGGDEGRTVYFFTNDGRMLVKYSRGG--------ELWI
DSQ  ATGCTCCCGCAGTCGGGCAAC------------------------------GGCACCAAGAGGAGTGCCAAGTACGCAGACCATGCGGTGGAAATGATGACCGAAGCGATGGAAAGGCTGGGAAGTGACAGGAAAAGGATAGTTGCGAAGATGGCAGGAGGTGCGCAGATTTTCAAGCACATGACGATG---GACATGCTCAGAATCGGCGACAGGAACGCTGAAGCCATCAGGACGATACTGAGGGATTACGGCATCAGGATTGTGTCGGAAGATTTGGGGGGTGACGAGGGGAGAACCGTCTATTTTTTTACAAATGATGGAAGGATGCTGGTCAAATACAGCAGGGGTGGA------------------------GAGTTGTGGATT
TRN  10010101100011011
NAM  Q9HQW9_HALN1/1-109
ASQ  MLPEADG----------PVDTPAKYVDSGLDEMVSALLRLGASPSTLTAKLAGGSTMLDLSIG---DSVGSRNVSAAERALADADIELLASETGGDSGRSVSFSPSSGDVTIDRVDAE--------VHVI
DSQ  ATGCTGCCGGAAGCCGACGGC------------------------------CCCGTGGACACGCCCGCGAAATACGTCGATTCGGGTCTCGACGAGATGGTGTCGGCGCTGCTCCGCCTGGGCGCGAGCCCGAGCACCCTCACGGCGAAACTCGCCGGCGGGTCGACGATGCTCGACCTCTCGATCGGG---------GACAGCGTCGGCTCCCGGAACGTGTCGGCCGCCGAACGCGCGCTGGCCGACGCGGACATCGAGTTGCTCGCGTCCGAAACCGGCGGGGACAGCGGACGGTCGGTGTCCTTTAGTCCGAGCAGTGGGGATGTTACCATAGACCGAGTTGATGCCGAG------------------------GTGCACGTAATT
TRN  10010101100011011
NAM  O51551_BORBU/55-163
ASQ  VLVKSDL-D-------ISPDQRGRYGIYAIPMLINAMLENGASKSNLKAKLFGGTNFMAKGSV----KVGLENSEFAVNTLNKYRIPILAKDFDQSKSRKIFAFPENFKVIVEYPDGT---------KVF
DSQ  GTTCTAGTTAAGTCAGATCTT---GAC---------------------ATATCTCCTGATCAAAGGGGAAGATATGGGATTTATGCTATTCCTATGTTAATAAATGCAATGCTCGAAAATGGAGCTAGCAAAAGTAATCTTAAGGCTAAGCTTTTTGGTGGAACTAATTTTATGGCAAAAGGATCGGTT------------AAGGTGGGGCTTGAAAATTCAGAGTTTGCCGTTAATACATTGAATAAGTATCGTATTCCAATCTTAGCTAAAGATTTTGATCAATCTAAGTCGCGAAAAATTTTTGCTTTTCCTGAAAACTTTAAGGTTATTGTGGAATATCCAGACGGAACA---------------------------AAGGTTTTT
TRN  10010101110011000
NAM  O87719_CAUCR/58-168
ASQ  LLPDSGD-G-------RRDGDAVRYGAYAMEVLINDLLKRGARRERLEAKIFGGAKLFDGLSD-----VGASNAAFAERFLRDEGIPIVSSSTGGVSARRVEFWPASGRVRQRLVAVDN------APQDV
DSQ  CTGCTGCCGGACTCCGGCGAC---GGG---------------------CGCCGGGACGGCGACGCCGTCCGCTATGGCGCCTATGCGATGGAAGTGCTGATCAACGACCTCCTGAAGCGCGGCGCGCGACGCGAGCGTCTTGAGGCCAAGATCTTCGGCGGCGCCAAGCTGTTCGACGGCCTGTCGGAC---------------GTTGGCGCCAGCAACGCCGCCTTCGCCGAACGTTTCCTGCGCGACGAAGGCATTCCGATCGTCTCGTCCAGCACAGGCGGCGTCTCGGCCCGGCGCGTGGAGTTCTGGCCGGCGTCCGGTCGGGTTCGTCAGCGTCTGGTCGCCGTCGACAAC------------------GCGCCGCAGGACGTC
TRN  11011111101111111
NAM  Q9KKL4_VIBCH/92-216
ASQ  LLPFNNQFESQHWHPQALLSDSSRYGCYAMEVLINRLLSMGAERERLKFKLFGGAHLMGYQSL-----VGEKNVEFVLEYAKREKLNVVAQDLGGAQPRKLLFDPQTGQAWVKRIGFSSAHAIKQDEELY
DSQ  TTGCTGCCTTTTAATAACCAATTTGAAAGCCAACATTGGCATCCACAAGCGTTATTGTCGGACTCTTCTCGCTACGGATGTTATGCAATGGAGGTCTTGATTAATCGGTTATTGTCCATGGGGGCAGAGCGAGAGAGATTGAAGTTTAAACTGTTTGGTGGCGCTCACTTAATGGGGTACCAGTCGCTG---------------GTTGGGGAAAAAAACGTCGAGTTTGTGCTTGAGTATGCCAAACGTGAAAAGCTAAACGTCGTGGCGCAAGATTTGGGAGGCGCTCAACCGCGAAAATTGTTGTTTGATCCACAGACCGGGCAGGCATGGGTAAAACGCATTGGATTTAGTTCGGCGCATGCAATTAAACAGGATGAAGAACTCTAT
TRN  10010101100011010
NAM  Q9I6V8_PSEAE/66-184
ASQ  MLPERGLGG-------DPASPSARYGSHAMELLINRMLALGASRERLQAKVFGGGSVLRQISA----AIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGRVLVKSLVELKNDTVLQRERDY
DSQ  ATGCTCCCCGAGCGCGGCCTCGGCGGC---------------------GACCCGGCCTCGCCGTCGGCGCGCTACGGCAGCCACGCCATGGAACTGCTGATCAACCGCATGCTGGCCCTCGGCGCCAGCCGCGAGCGCCTGCAGGCCAAGGTCTTCGGCGGCGGCTCGGTACTGCGCCAGATCAGCGCC------------GCCATCGGCCAGCGCAACGTCGAGTTCACCCTCGACTACCTGGCCACCGAGCGTATCCCGCTGCTCGCCAGCGACGTGCTGGAGGCCTTCCCGCGCAAGATCTACTTCTTCCCGCGCAATGGCCGGGTCCTGGTGAAGTCCCTGGTGGAGCTGAAGAACGACACCGTGCTGCAGCGTGAACGCGACTAC
TRN  11011111101111111
//