EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03974 - Ecotin)
FAM  PF03974
PID  Ecotin
DES  Ecotin
IPR  IPR005658
ANO  2
ALN  160
AID  0.557047
APH  (ECOT_PSEAE/1-154:0.41280,ECOT_ECOLI/1-160:0.22413);
ATP  (ECOT_PSEAE/1-154,ECOT_ECOLI/1-160);
ATL  0.63693
DNO  2
DLN  480
DID  0.61039
DPH  (ECOT_PSEAE/1-154:0.17919,ECOT_ECOLI/1-160:0.37460);
DTP  (ECOT_PSEAE/1-154,ECOT_ECOLI/1-160);
DTL  0.5538
RID  0.557047
RPH  (ECOT_PSEAE/1-154:0.50955,ECOT_ECOLI/1-160:0.12738);
RTP  (ECOT_PSEAE/1-154,ECOT_ECOLI/1-160);
RTL  0.63693
LNK  ECOT_ECOLI/1-160:P23827:M60876
LNK  ECOT_PSEAE/1-154:Q9I088:AE004703
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ECOT_PSEAE/1-154
ASQ  MKALLIAAGVAALSSTAMAAK-----LDEKVPYPKADAGFTRQVIHLPKQDAEDAFKVEIIAGKTLEADCNQQRLGGELEEHTLEGWGYSYYRLDKVSGPMSTMMACPGQKKEQRFIPV-VGEGFLLCYNSKLPIVVYAPKDVEVRYRIWSASEKVEKAV
DSQ  ATGAAAGCACTACTGATCGCCGCCGGCGTTGCCGCTCTTTCCAGCACCGCCATGGCCGCCAAA---------------CTGGATGAAAAGGTTCCCTACCCGAAGGCAGATGCCGGCTTCACCCGCCAGGTCATCCACCTGCCGAAACAGGACGCGGAAGACGCATTCAAGGTCGAGATCATCGCCGGCAAGACCCTCGAGGCCGACTGCAACCAGCAGCGCCTGGGCGGCGAGCTGGAAGAACACACCCTGGAAGGCTGGGGCTACTCCTACTACCGCCTGGACAAGGTCAGCGGGCCGATGAGCACGATGATGGCCTGCCCCGGCCAGAAGAAGGAGCAGCGCTTCATCCCGGTG---GTCGGCGAAGGCTTCCTGCTGTGCTACAACAGCAAGCTGCCGATCGTGGTCTATGCGCCGAAGGACGTGGAGGTCCGCTATCGGATCTGGTCGGCGTCCGAAAAGGTCGAGAAAGCGGTC
TRN  11011101101011011
NAM  ECOT_ECOLI/1-160
ASQ  MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAV
DSQ  ATGAAGACCATTCTACCTGCAGTATTGTTTGCCGCTTTCGCTACCACTTCCGCCTGGGCGGCAGAAAGCGTCCAGCCACTGGAAAAAATCGCGCCTTATCCACAAGCTGAAAAAGGGATGAAGCGTCAGGTGATTCAGTTAACCCCGCAAGAAGATGAATCTACCCTGAAAGTAGAACTGTTAATCGGTCAGACGCTGGAAGTCGATTGCAATTTGCATCGTCTCGGCGGGAAGCTGGAAAACAAAACGCTGGAAGGCTGGGGCTATGATTATTATGTCTTTGATAAAGTCAGTTCCCCGGTTTCAACGATGATGGCCTGCCCGGATGGCAAGAAAGAGAAGAAATTTGTCACCGCGTATCTGGGCGATGCTGGAATGCTGCGTTACAACAGCAAGCTGCCGATCGTGGTGTATACGCCAGACAATGTAGATGTGAAGTACCGCGTCTGGAAGGCGGAAGAGAAAATTGACAACGCGGTA
TRN  11011101101011000
//