EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03971 - IDH)
FAM  PF03971
PID  IDH
DES  Monomeric isocitrate dehydrogenase
IPR  IPR004436
ANO  6
ALN  736
AID  0.614881
APH  (Q9PHY3_CAMJE/2-730:0.48325,((Q9KSW5_VIBCH/7-741:0.16593,Q9PA20_XYLFA/23-757:0.30134):0.05001,Q9JZS1_NEIMB/6-740:0.22827):0.05499,(Q9I0L4_PSEAE/6-739:0.16839,O53611_MYCTU/7-742:0.25024):0.08323);
ATP  (Q9PHY3_CAMJE/2-730,((Q9KSW5_VIBCH/7-741,Q9PA20_XYLFA/23-757),Q9JZS1_NEIMB/6-740),(Q9I0L4_PSEAE/6-739,O53611_MYCTU/7-742));
ATL  1.78565
DNO  6
DLN  2208
DID  0.599579
DPH  ((((Q9PHY3_CAMJE/2-730:0.47157,Q9PA20_XYLFA/23-757:0.24714):0.09961,Q9KSW5_VIBCH/7-741:0.20025):0.09728,Q9JZS1_NEIMB/6-740:0.20537):0.12635,Q9I0L4_PSEAE/6-739:0.16321,O53611_MYCTU/7-742:0.19647);
DTP  ((((Q9PHY3_CAMJE/2-730,Q9PA20_XYLFA/23-757),Q9KSW5_VIBCH/7-741),Q9JZS1_NEIMB/6-740),Q9I0L4_PSEAE/6-739,O53611_MYCTU/7-742);
DTL  1.80725
RID  0.614881
RPH  (Q9PHY3_CAMJE/2-730:0.48325,((Q9KSW5_VIBCH/7-741:0.16593,Q9PA20_XYLFA/23-757:0.30134):0.05001,Q9JZS1_NEIMB/6-740:0.22827):0.05499,(Q9I0L4_PSEAE/6-739:0.16839,O53611_MYCTU/7-742:0.25024):0.08323);
RTP  (Q9PHY3_CAMJE/2-730,((Q9KSW5_VIBCH/7-741,Q9PA20_XYLFA/23-757),Q9JZS1_NEIMB/6-740),(Q9I0L4_PSEAE/6-739,O53611_MYCTU/7-742));
RTL  1.78565
LNK  O53611_MYCTU/7-742:O53611:BX842572
LNK  Q9I0L4_PSEAE/6-739:Q9I0L4:AE004691
LNK  Q9JZS1_NEIMB/6-740:Q9JZS1:AE002443
LNK  Q9KSW5_VIBCH/7-741:Q9KSW5:AE004194
LNK  Q9PA20_XYLFA/23-757:Q9PA20:AE004076
LNK  Q9PHY3_CAMJE/2-730:Q9PHY3:AL139075
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PHY3_CAMJE/2-730
ASQ  QITYTLTDESPALATYSFLPIVKAFLSRAHIGVKTSDISLSGRILATFSEYLKEEQRCEDALELLGELVKRSDANLIKTPNISASIPQLKAAIKELQDKGYMLPNYPDEPKNDEELQIKTKYQKVLGSAVNPVLRQGNSDRRSTKAVKDYAKNNPYRVVEFNPNSKTRVSYMKEGDFFSNEKAVLIDQDCVANIEFTSVDGKKEILKEGLKLEKNEILDATFMDVQKLQEFYAKEIKASKDDDVLFSLHLKATMMKVSDPILFGYAVKVFFKELFIEFQDEFEKLGINPNNGLSELLSKIE--NSSKKDEILKKYSEILAKSADISMVNSDKGITNLHVPSDVIVDASMPAMLKNGARLWDKEGKEKDTNAVIPDQTYATIYEAVIEDLHKNGTLNPSKLGSVSNVGLMAKKAQEYGSHDKTFVAKEEGTFKIV.-SNGKVLLEHKVRKGDIYRANQAKFDAVLNWIDLGIERSELSGAEAIFWLDSKRASNKIMITLVQNRLKE---KGKNVAILTPKEACLRSLELIREGKDVISITGNVLRDYLTDLFPILELGTSAKMLSVVPMLNGGAMFETGAGGSAPKQVEQLVEENHLRWDSLGEFLALQASLEFYANKCGNHKAKVLAECLDEAIGEWLENNKAPSRKVKEDDNRTSHFYLAMYFANHLARQASDMELQSFFKDIALELSSNEEKIRAEFNDAQGVKVDLGGYYKFDDEKANKIMRPSATFNAILEK
DSQ  CAAATTACTTATACCTTAACAGATGAGTCGCCAGCTCTTGCGACTTATTCGTTTTTGCCTATAGTGAAAGCTTTTTTAAGTAGGGCACATATAGGAGTAAAAACCTCGGATATTTCTTTGTCTGGAAGGATTTTAGCTACTTTTAGTGAGTATTTAAAAGAGGAACAAAGATGTGAAGATGCTTTAGAGCTTTTAGGCGAGCTTGTCAAAAGATCGGATGCAAATCTTATTAAAACCCCAAATATTTCAGCTTCTATTCCTCAGCTTAAGGCGGCGATTAAAGAATTGCAAGATAAGGGTTATATGTTACCAAATTACCCAGATGAGCCAAAAAATGATGAAGAATTGCAAATTAAAACAAAATATCAAAAAGTTTTAGGTTCAGCGGTTAATCCTGTATTAAGACAAGGAAATTCAGATCGTCGTTCAACAAAAGCGGTAAAAGACTATGCAAAAAACAATCCTTATCGTGTGGTTGAGTTTAATCCAAACTCAAAAACTCGTGTTTCTTACATGAAAGAAGGGGATTTTTTCTCTAATGAAAAAGCGGTTTTAATCGATCAAGATTGTGTGGCTAATATAGAATTTACAAGCGTTGATGGTAAAAAAGAAATTTTAAAAGAGGGCTTAAAACTTGAAAAAAATGAAATTTTAGACGCTACTTTTATGGATGTGCAAAAACTTCAGGAATTTTATGCAAAAGAAATTAAAGCAAGCAAAGATGATGATGTGCTTTTTTCTTTGCATTTAAAAGCTACAATGATGAAAGTAAGTGATCCTATACTTTTTGGTTATGCGGTAAAAGTATTTTTTAAAGAATTATTTATCGAATTTCAAGATGAATTTGAAAAATTAGGCATTAATCCAAATAATGGTTTAAGTGAGCTTTTAAGTAAGATCGAA------AATTCAAGCAAAAAAGATGAAATTTTAAAAAAATACAGTGAAATTTTAGCTAAATCTGCAGATATTTCTATGGTAAATTCAGATAAAGGCATTACAAATCTTCATGTTCCAAGCGATGTTATCGTTGATGCTTCTATGCCTGCAATGCTTAAAAATGGCGCAAGATTGTGGGATAAGGAAGGTAAGGAAAAGGACACAAATGCCGTAATTCCTGATCAAACTTACGCAACTATTTATGAGGCGGTTATTGAAGATTTGCATAAAAATGGTACTTTAAATCCTTCAAAACTTGGCAGTGTATCTAATGTAGGTTTAATGGCTAAAAAAGCTCAAGAATATGGATCGCACGATAAAACCTTTGTGGCTAAAGAAGAAGGAACTTTTAAAATAGTT...---TCTAACGGTAAAGTTTTATTAGAACATAAGGTTAGAAAAGGTGATATTTATAGAGCTAATCAGGCTAAATTTGATGCAGTGTTAAATTGGATTGATTTAGGTATAGAAAGATCAGAACTTAGTGGAGCCGAAGCTATTTTTTGGTTAGATAGCAAAAGAGCTAGTAATAAAATCATGATAACTTTGGTACAAAATCGTTTAAAAGAA---------AAGGGTAAAAATGTAGCCATTTTAACTCCAAAAGAAGCTTGTTTAAGAAGTTTAGAGTTAATCCGAGAAGGTAAAGATGTTATTTCTATCACGGGTAATGTTTTAAGGGATTATTTAACCGATCTTTTTCCTATTTTAGAGCTTGGAACAAGTGCAAAAATGCTTTCTGTTGTGCCTATGTTAAATGGTGGAGCTATGTTTGAAACAGGAGCAGGGGGTTCAGCACCTAAACAAGTAGAACAATTAGTCGAAGAAAATCATCTGCGTTGGGATAGTTTGGGTGAATTTTTGGCTTTGCAAGCAAGTTTGGAATTTTATGCAAATAAGTGTGGCAATCATAAAGCTAAGGTTTTAGCAGAATGTCTTGATGAGGCTATAGGCGAATGGCTTGAAAATAATAAAGCTCCATCAAGAAAAGTCAAAGAAGATGATAATAGAACAAGTCATTTTTATTTAGCAATGTATTTTGCAAATCATTTAGCAAGACAGGCAAGTGATATGGAGCTTCAAAGCTTTTTTAAAGATATTGCCCTAGAGCTTTCTTCTAATGAAGAAAAAATCAGAGCCGAATTTAACGATGCACAAGGTGTGAAAGTGGATTTGGGTGGGTATTATAAATTTGATGATGAAAAAGCAAATAAAATCATGCGTCCAAGTGCAACTTTTAACGCTATTTTAGAAAAA
TRN  10010101100011000
NAM  Q9PA20_XYLFA/23-757
ASQ  KLIYTLTDEAPFLATQSLLPIIKAYTKVAGIQVETRDISLAGRILAKFPDVLTETQRVSDDLAELGEMTASPDANIIKLPNISASMPQLKAAIKELQEQGYLLPDYPDEPKNSAQKDVKIRYDRVKGSAVNPVLREGNSDRRAPLSVKNYVRKYPHRMGAWSTTSKSHVAHMEGGDFFGSERSAVLAQAGMLKVELIAKDGTVTVLKDKVAVSAGDIVDAAVLSKQALAVFVAAQMSDAKSQGVLFSVHLKATMMKVSDPVIFGVFVSEFYKEALTKHADTLKQVGFDPNNGIGDLYARIVALPEEMQAVIRADVQAQYAKCPGLAMVNSDKGITNLHVPSDVIVDASMPAMIRSSGQMWNVAGTLQDTKAVIPDRCYAGVYKTVIDDCKLHGAFDPVTMGSVPNVGLMAQKAEEYGSHDKTFQVQSGGVVRVS.DDWGEVLFEHSVEVGDLWRMCQTKDAPIQDWVRLAVERARLSHVPAVFWLDSARAHDVQVIAKVERYLKDHDTNGLDIRIMSPVAAMEFSLARIRKGQDTISVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQFTEENYLRWDSLGEFLALAASLEHLGNRYDHVAAKVLAKALDVANGQILDNNKSPAREIGELDNRGSHFYLALYWAQALAAQDEDVALQVKFASLAKVLSEHEVAIVADLNVVQGFPVDIGGYYHPDLARVAAAMQPSKTFNDALRL
DSQ  AAGCTTATTTATACACTTACAGACGAGGCGCCGTTCTTGGCAACGCAGTCGCTATTGCCAATTATCAAGGCTTACACCAAGGTTGCTGGTATCCAGGTTGAGACACGTGATATTTCTTTGGCCGGGCGTATCTTGGCGAAGTTTCCTGATGTGTTGACCGAGACGCAAAGAGTCAGTGACGATCTGGCTGAGTTGGGGGAAATGACGGCTAGTCCGGATGCCAACATTATTAAGTTGCCTAATATCAGTGCTTCAATGCCGCAGTTAAAGGCTGCTATCAAAGAGTTGCAGGAGCAGGGCTATTTGTTGCCGGATTATCCGGATGAACCAAAAAACAGTGCGCAAAAGGATGTCAAGATACGCTATGACAGGGTGAAGGGGAGTGCGGTCAATCCCGTACTGCGTGAAGGCAATTCTGATCGCCGTGCCCCGTTGTCAGTCAAGAATTATGTGCGTAAGTATCCGCATCGGATGGGGGCGTGGAGTACTACATCCAAGTCGCATGTCGCACATATGGAGGGCGGTGATTTTTTCGGTAGTGAACGTTCGGCTGTACTCGCTCAGGCTGGTATGTTGAAGGTCGAGCTGATTGCTAAGGATGGCACGGTGACGGTACTCAAGGACAAGGTTGCAGTGAGTGCCGGTGATATTGTGGATGCTGCGGTGCTGAGTAAGCAGGCATTGGCTGTGTTTGTTGCTGCACAGATGAGTGATGCGAAGTCACAGGGGGTGCTGTTTTCGGTACACCTGAAGGCGACGATGATGAAGGTGTCCGATCCGGTGATATTTGGGGTGTTTGTTTCAGAGTTCTACAAAGAGGCTTTGACCAAGCATGCTGACACGTTGAAACAGGTCGGTTTTGATCCTAACAATGGTATTGGCGATTTGTACGCACGCATTGTTGCGTTGCCGGAGGAGATGCAGGCAGTCATCAGGGCTGATGTGCAGGCTCAGTATGCCAAATGTCCTGGTTTGGCGATGGTTAATTCGGACAAGGGGATCACTAATTTGCATGTGCCTAGTGATGTGATTGTGGATGCGTCGATGCCGGCGATGATCCGTAGTTCTGGGCAGATGTGGAACGTTGCAGGCACGCTCCAAGACACTAAAGCAGTGATTCCGGATCGTTGTTATGCCGGCGTGTATAAAACTGTCATTGATGATTGCAAGTTACACGGTGCTTTTGATCCAGTGACGATGGGTTCGGTGCCCAATGTCGGTTTGATGGCGCAGAAGGCTGAGGAATATGGTTCGCACGACAAAACGTTTCAGGTACAGAGTGGGGGTGTAGTCCGTGTCAGT...GATGATTGGGGTGAGGTGTTGTTCGAGCATTCGGTAGAGGTGGGTGATCTTTGGCGCATGTGTCAAACGAAGGATGCACCGATCCAGGATTGGGTCAGGTTGGCGGTGGAACGTGCCCGTCTGAGTCATGTTCCGGCAGTGTTCTGGTTGGACAGCGCCCGTGCGCATGATGTGCAGGTGATTGCAAAAGTTGAGCGTTATTTAAAAGATCACGATACCAACGGTTTGGATATACGTATTATGTCGCCGGTGGCAGCGATGGAATTTTCGCTGGCCCGTATTCGTAAAGGTCAGGACACGATTTCGGTGACCGGGAATGTGTTGCGGGATTATTTGACCGATTTATTCCCAATCATGGAATTGGGCACCAGTGCCAAGATGCTTTCCATTGTTCCGTTAATGGCGGGAGGTGGTTTGTTTGAAACCGGTGCCGGTGGTTCCGCGCCGAAGCATGTACAGCAATTTACTGAGGAGAATTACTTGCGTTGGGATTCGTTGGGTGAGTTTCTGGCGTTGGCTGCATCGTTGGAGCATCTTGGTAACCGCTATGATCATGTTGCTGCAAAGGTGTTAGCGAAAGCGCTGGACGTGGCTAACGGTCAAATTTTGGATAATAACAAATCTCCTGCGCGTGAAATCGGTGAGTTGGATAATCGTGGCAGCCATTTTTATCTCGCTTTGTATTGGGCTCAGGCATTAGCTGCACAGGATGAGGATGTTGCGTTGCAGGTTAAGTTTGCATCTTTGGCTAAAGTCCTGAGTGAGCATGAGGTAGCCATCGTTGCTGATCTCAATGTGGTTCAGGGATTTCCAGTGGATATTGGTGGTTATTATCATCCTGATTTGGCTAGGGTTGCTGCTGCGATGCAGCCTAGTAAGACCTTCAACGATGCGTTGAGATTG
TRN  10010101100011000
NAM  Q9JZS1_NEIMB/6-740
ASQ  TIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTSDISLSGRILAAFPEYLTEAQRVPDALAELGELVKQPDANVIKLPNISASVPQLTAAIKELQSKGFAVPDYPADPQTDEEKAVRERYDRIKGSAVNPVLREGNSDRRAPKAVKNFAKKNPHSMGAWTKDSKTHVATMQSGDFFHNEQSVIVPEATSVSIVFTDKQGNKKELREPVALKAGEIIDATVMSKKALLAFLAEQVKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFEKFGDKLAAAGVNVNNGFGNLLANLDKLDADTRTAVEAEIAAVYAANPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRNSGRMWDKNGKAQDTKAVIPDSSYAGVYQATIDFCREHGAFDPTTMGTVPNVGLMAQAAEEYGSHNKTFEIEADGQVQVI.DAAGKVLMQHDVEAGDIWRMCQTKDAPVKDWVQLAVNRARLSNTPAVFWLDENRPHDKSLLAKVKAYLAELDTNGLDIRVLAPEEAAKFSLGRLKNGEDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGMFETGAGGSAPKHVQQFLEENHLRWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLDAATEKLLLNDKSPKRKAGELDNRGSHFYLTLYWAQELAAQDKDAELKAAFTPLAAALTADEAKIVAELSAVQGKAADIGGYYAANPEKAAQVMRPSVTFNQALNA
DSQ  ACCATTGTTTATACCCATACCGACGAAGCACCCGCGCTGGCGACCCAATCGCTGCTGCCGATTGTGCAGGCTTTTGCCCGCCACGCCGATATTGATGTCAAAACCAGCGACATTTCTCTCTCCGGCCGTATTTTGGCGGCGTTTCCCGAATACCTGACCGAAGCGCAACGCGTACCTGATGCGCTTGCCGAATTGGGCGAACTGGTGAAACAACCCGATGCAAACGTAATCAAACTGCCGAACATCAGCGCGTCCGTACCGCAACTGACTGCCGCGATTAAAGAATTGCAATCTAAAGGCTTTGCCGTTCCCGACTATCCCGCCGACCCGCAAACCGATGAAGAAAAAGCCGTACGCGAACGCTACGACCGCATCAAAGGCAGCGCGGTAAACCCTGTCCTGCGTGAAGGCAACTCCGACCGTCGCGCCCCTAAAGCAGTGAAAAACTTTGCGAAAAAAAATCCGCACAGCATGGGCGCATGGACCAAAGACTCCAAAACCCACGTTGCCACCATGCAAAGCGGCGACTTTTTTCATAACGAACAATCTGTTATCGTACCTGAAGCGACTTCCGTATCCATCGTATTCACCGACAAACAAGGCAACAAAAAAGAGCTGCGCGAGCCCGTCGCCCTGAAAGCCGGCGAAATCATCGACGCGACCGTGATGAGTAAAAAAGCCCTGCTCGCCTTCCTTGCCGAACAAGTAAAAGATGCGAAAGCAAAAGGCGTGTTGTTCTCGCTGCACATGAAAGCCACTATGATGAAAGTGTCCGACCCGATTATCTTCGGACACGCCGTCAAAGTATTCTTCGCGCCTGTTTTTGAAAAATTCGGCGACAAACTGGCTGCTGCCGGCGTCAACGTTAACAACGGCTTCGGCAACCTGCTTGCCAATCTGGACAAACTGGATGCGGACACCCGCACCGCCGTCGAAGCCGAAATCGCCGCCGTTTACGCTGCCAACCCCGATTTGGCGATGGTTGATTCCGACAAAGGCATCACCAACCTGCACGTTCCCAGCGATGTCATCGTCGATGCCTCTATGCCTGCGATGATTCGCAATTCCGGCCGTATGTGGGACAAAAACGGCAAAGCGCAAGACACCAAAGCCGTGATTCCCGACAGCAGCTATGCCGGCGTTTACCAAGCAACCATCGACTTCTGCCGCGAACACGGCGCATTTGACCCGACAACCATGGGTACTGTGCCCAACGTCGGACTGATGGCGCAAGCGGCGGAAGAATACGGCTCGCACAACAAAACCTTTGAAATCGAAGCCGACGGCCAAGTCCAAGTCATT...GATGCGGCAGGAAAAGTCCTAATGCAGCACGACGTTGAAGCCGGCGACATCTGGCGTATGTGCCAAACCAAAGACGCTCCGGTTAAAGACTGGGTACAACTTGCCGTCAACCGCGCCCGTCTGAGCAACACGCCTGCCGTGTTCTGGCTCGACGAAAACCGTCCGCACGACAAGAGCCTGCTCGCCAAGGTTAAAGCCTACCTTGCCGAACTGGATACCAATGGCCTCGACATCCGCGTCCTCGCTCCTGAAGAAGCCGCCAAGTTCAGCTTGGGTCGTCTGAAAAACGGCGAAGACACCATCTCCGTAACCGGTAATGTCTTGCGCGACTACCTGACCGACTTGTTCCCAATTTTGGAACTCGGCACAAGCGCGAAAATGCTGTCTATCGTTCCATTGATGAACGGCGGCGGTATGTTTGAAACCGGCGCGGGCGGTTCTGCACCGAAACATGTTCAACAATTCCTCGAAGAAAACCATTTGCGCTGGGACTCGCTGGGCGAATTCCTCGCACTCGCCGTATCGTTTGAACATTTGGCGCAAAAAACCGGCAATGCCAAAGCCCAAGTCCTCGCCGACACTTTGGATGCAGCCACCGAAAAACTGCTGTTGAACGACAAATCGCCTAAACGTAAAGCCGGCGAACTCGACAACCGCGGCAGCCATTTCTACCTCACCCTCTACTGGGCGCAAGAATTGGCGGCGCAAGACAAAGATGCCGAACTGAAAGCCGCATTTACGCCATTGGCAGCCGCTTTGACCGCCGACGAAGCGAAAATCGTTGCCGAGCTTTCCGCCGTACAAGGCAAAGCGGCCGACATCGGCGGCTACTACGCCGCCAATCCTGAAAAAGCCGCACAAGTGATGCGTCCGAGCGTAACCTTTAATCAGGCACTAAACGCC
TRN  11011101101011011
NAM  Q9KSW5_VIBCH/7-741
ASQ  TIIYTITDEAPALATYSLLPIIQSFTASSGINVETRDISLAGRILANFPEHLTEEQRISDALTELGELAKTPEANIIKLPNISASVPQLKAAIKELQDKGYALPNYPEEPSSYEEEAIKATYDKIKGSAVNPVLREGNSDRRAPASVKNYAKKNPHSMGAWSKDSKSHVASMSDKDFFGSEKSMTVSGATKVAIEFVGKEGAVKVLKKPFALQDKEIIDTSVMSKKALIAFFEKEIADAKAQDVLFSLHMKATMMKVSDPVIFGHAVKVYYKAVFDKYGQLFDQLGVDVNNGLGDVYAKIQSLPEAQRAEIEAAIQAVYATQPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGQMWGPDGKQKDTKATIPDRCYAGVYQTVIDFCKQHGAFDPTTMGSVPNVGLMAQKAEEYGSHDKTFILDAEGVVRVI.DEAGKVLLEQSVEAGDIFRMCQVKDAPIQDWVKLAVTRARASNTPAVFWLDPARAHDAELIKKVNQYLPNHDTSGLEIKILSPIEATQYSLVRMKAGQDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQVQKENHLRWDSLGEFLALAASLEHLSVVTGNRKAQVLADALDKATGKFLDMNKSPSRRVGEIDNRGSHFYLATYWAQALAEQTADADLAAEFAPIAKALEEKEAQIVAELNGAQGKPGDLGGYYAPEFAKVAPLMRPSSTFNAIIDR
DSQ  ACAATTATTTATACCATTACTGATGAAGCCCCAGCGCTGGCAACGTATTCATTACTGCCGATTATTCAATCATTTACTGCTTCATCAGGCATTAACGTAGAAACACGCGATATTTCATTAGCTGGTCGTATTCTGGCTAATTTCCCTGAGCATTTGACCGAAGAACAACGTATCAGCGATGCGTTGACTGAACTGGGTGAGCTAGCAAAAACGCCTGAAGCGAACATCATTAAACTGCCAAATATTTCTGCTTCTGTTCCTCAACTCAAAGCGGCGATTAAAGAGCTGCAAGACAAAGGCTACGCACTGCCAAATTACCCAGAAGAACCGAGTAGCTACGAAGAAGAAGCGATCAAAGCAACTTATGACAAGATCAAGGGTAGCGCGGTAAACCCAGTGTTACGTGAAGGTAACTCCGATCGCCGTGCTCCAGCCTCGGTGAAAAACTACGCCAAGAAAAACCCGCACTCCATGGGCGCTTGGAGTAAGGATTCAAAATCACATGTTGCAAGCATGAGCGATAAAGATTTCTTCGGTAGCGAGAAGTCGATGACGGTGAGCGGCGCAACTAAAGTGGCGATTGAGTTCGTGGGTAAAGAGGGTGCAGTGAAAGTGCTGAAAAAGCCTTTTGCGCTGCAAGATAAAGAGATCATCGATACCAGCGTGATGAGCAAAAAAGCGCTGATTGCCTTCTTTGAAAAAGAAATCGCGGATGCGAAAGCGCAAGACGTGCTGTTCTCACTGCACATGAAAGCGACCATGATGAAAGTCTCGGATCCAGTGATCTTCGGTCATGCGGTGAAGGTGTACTACAAAGCGGTTTTTGATAAGTATGGTCAACTGTTCGATCAGCTGGGTGTGGACGTTAATAACGGCTTAGGTGATGTCTACGCTAAAATTCAATCGCTGCCAGAAGCGCAACGTGCAGAAATTGAAGCGGCGATTCAAGCGGTATATGCGACGCAACCCGCTCTGGCGATGGTGGACTCTGACCGCGGTATCACCAACCTGCATGTACCAAGCGATGTGATTGTTGATGCGTCTATGCCAGCAATGATCCGTACTTCAGGCCAAATGTGGGGCCCTGATGGTAAGCAGAAAGACACCAAAGCGACGATTCCCGATCGCTGCTACGCAGGCGTTTACCAAACCGTCATCGATTTCTGTAAACAGCACGGCGCGTTTGACCCAACTACTATGGGCAGTGTGCCCAACGTGGGTCTGATGGCACAAAAAGCAGAAGAGTACGGCTCACACGATAAGACCTTTATTCTGGATGCTGAAGGTGTGGTGCGTGTGATT...GACGAAGCGGGCAAAGTGCTGCTGGAACAAAGCGTGGAAGCGGGCGACATCTTCCGCATGTGTCAGGTAAAAGATGCGCCAATCCAAGATTGGGTAAAATTGGCGGTAACTCGTGCTCGCGCTTCCAACACGCCAGCCGTTTTCTGGCTGGATCCTGCACGCGCTCATGACGCTGAGTTGATCAAGAAAGTGAATCAGTACCTACCTAATCACGATACCTCTGGTTTAGAAATCAAGATCCTGTCACCGATTGAAGCCACGCAATATTCACTTGTGCGTATGAAGGCGGGACAAGACACCATTTCTGTAACAGGTAACGTGCTACGTGATTACTTGACTGACTTATTCCCAATCCTTGAACTGGGTACTTCGGCGAAAATGCTCTCTATCGTTCCGTTGATGAACGGTGGTGGTTTGTTTGAAACGGGCGCGGGCGGCTCGGCACCGAAGCACGTACAACAAGTACAAAAAGAGAACCACTTACGTTGGGATTCACTGGGTGAGTTTTTAGCGCTAGCCGCATCTCTGGAGCACTTGAGTGTGGTCACTGGCAATCGCAAAGCACAAGTGTTGGCGGATGCGCTTGATAAAGCGACGGGTAAGTTCCTCGATATGAACAAATCGCCTTCACGCCGTGTCGGTGAAATTGACAACCGTGGTAGCCATTTCTATTTGGCGACTTACTGGGCGCAAGCACTGGCTGAACAAACGGCAGATGCAGATCTCGCAGCTGAGTTTGCTCCGATTGCAAAAGCGCTTGAAGAGAAAGAAGCGCAAATTGTCGCAGAACTGAATGGCGCGCAAGGCAAGCCTGGCGATTTGGGTGGCTATTACGCACCTGAGTTTGCGAAGGTGGCTCCGCTTATGCGTCCTAGCTCGACCTTCAACGCGATCATTGACCGT
TRN  11011101101011000
NAM  O53611_MYCTU/7-742
ASQ  TIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDISVAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQDKGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHSMGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGDVIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAFAKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGISNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNGQFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVdVATGEVLLTENVEAGDIWRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGLDIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMAGGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKTLDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVLTKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEA
DSQ  ACCATCATTTACACGCTGACCGACGAGGCGCCGCTGCTGGCGACCTACGCCTTTCTGCCGATTGTGCGTGCCTTTGCCGAACCGGCGGGCATCAAGATCGAGGCCAGCGACATCTCTGTAGCGGCACGCATCCTGGCGGAATTCCCCGATTACCTGACCGAGGAGCAGCGGGTACCGGATAACCTCGCCGAACTGGGCCGGCTGACTCAGCTACCCGACACCAACATCATCAAGCTGCCGAACATCAGCGCCTCGGTGCCACAGCTGGTAGCCGCCATCAAGGAACTGCAAGACAAGGGTTACGCGGTCCCAGACTACCCGGCGGACCCGAAGACTGACCAGGAGAAGGCCATCAAAGAGCGCTACGCCAGATGCCTGGGCAGCGCGGTGAACCCGGTACTGCGCCAAGGCAATTCGGACCGTCGGGCGCCCAAGGCGGTGAAGGAGTACGCGCGCAAGCACCCGCACAGCATGGGCGAGTGGTCGATGGCCTCACGCACCCACGTAGCGCACATGCGGCACGGTGACTTCTACGCCGGCGAGAAGTCGATGACACTGGACCGCGCGCGCAACGTGAGGATGGAACTGCTGGCCAAGAGCGGCAAGACGATCGTGCTCAAGCCCGAGGTGCCGCTGGATGACGGCGACGTCATCGACAGCATGTTCATGAGCAAGAAAGCGCTGTGCGACTTCTACGAAGAGCAGATGCAGGATGCGTTCGAGACCGGCGTGATGTTCTCCTTGCACGTCAAGGCGACCATGATGAAGGTCAGCCACCCCATCGTCTTCGGCCACGCGGTCAGGATCTTCTACAAGGACGCCTTCGCCAAGCACCAGGAGCTGTTCGACGACTTGGGCGTCAACGTCAACAATGGCTTGTCCGATCTGTACAGCAAGATCGAGTCGCTGCCGGCGTCGCAACGCGACGAGATCATCGAGGACCTACACCGTTGCCACGAACACCGCCCCGAGCTCGCGATGGTCGATTCGGCCAGAGGTATCTCCAACTTCCACTCGCCGAGCGATGTGATCGTGGACGCCTCGATGCCCGCGATGATTCGCGCGGGCGGCAAGATGTATGGCGCCGACGGAAAGCTCAAGGACACCAAGGCGGTCAACCCGGAGTCCACCTTCTCGCGCATCTATCAGGAGATCATCAACTTCTGCAAGACAAATGGCCAGTTCGATCCGACGACGATGGGCACCGTCCCCAATGTGGGTCTGATGGCCCAGCAGGCCGAGGAGTACGGCTCGCACGACAAGACGTTCGAGATTCCCGAGGACGGCGTCGCCAACATCGTCgatGTCGCCACCGGCGAGGTGCTGCTGACCGAGAACGTGGAAGCCGGCGACATCTGGCGCATGTGCATCGTCAAGGACGCACCGATCCGTGACTGGGTCAAGCTGGCTGTCACCCGCGCGCGCATCTCCGGGATGCCGGTGCTGTTCTGGCTGGACCCGTACCGCCCGCACGAGAACGAGCTGATCAAGAAGGTCAAGACATACCTGAAAGATCACGACACCGAAGGTCTGGACATCCAGATCATGTCGCAAGTGCGATCCATGCGCTACACGTGCGAGCGCCTGGTCCGTGGACTGGACACCATCGCCGCGACCGGCAACATCCTGCGCGACTACCTCACCGACCTGTTCCCGATCCTGGAGTTAGGCACCAGCGCCAAGATGCTGTCCGTCGTTCCGCTGATGGCCGGCGGCGGAATGTACGAGACGGGGGCGGGCGGTTCGGCACCCAAGCACGTCAAACAATTGGTGGAGGAGAATCACCTGCGCTGGGATTCTCTGGGTGAGTTCCTCGCGCTGGGCGCCGGTTTCGAGGATATCGGCATCAAGACCGGTAACGAGCGGGCCAAACTCTTGGGTAAGACCCTGGATGCCGCCATCGGCAAGCTGCTGGACAACGACAAGAGTCCGTCGCGCAAAACCGGTGAACTCGACAACCGGGGCAGCCAGTTCTACCTCGCCATGTACTGGGCACAAGAGCTGGCCGCGCAGACCGACGACCAGCAGCTGGCCGAACACTTCGCCTCGCTGGCAGATGTGTTGACCAAAAACGAAGACGTCATCGTGCGAGAGCTCACCGAGGTACAAGGCGAACCGGTGGACATCGGCGGCTACTACGCGCCGGACAGCGACATGACTACGGCGGTGATGCGGCCCAGCAAGACGTTCAATGCAGCGCTGGAGGCT
TRN  10010101100011000
NAM  Q9I0L4_PSEAE/6-739
ASQ  KITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEADQRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEEKEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGGDFFSSEQSITMAKAGDVRIEFVGKDGKVEVKK-QLSLQEGEVLDSMFMSCGKLRDFFEKTLQDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSVYDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNSGQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEYGSHDKTFEMTADGTMRVV.LADGSVLMQHKVETGDIWRACQTKDAPIRDWVKLAVTRARQSDTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTISVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLRWDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSHFYLAMYWAQALAAQNEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNPELTSKVMRPSATFNAAIDS
DSQ  AAGATCACCTACACCTTCACCGACGAAGCACCCGCGCTCGCCACCTACTCGCTCCTCCCCATCGTCAAGGCCTTTGCCGCTTCCGCCGGCATCGACGTCGAGACCAGCGACATCTCTCTTGCAGGACGCATCCTGGCCAACTTCGCCGACCGCCTCGAAGCCGACCAGCGTATCGAAGACGACCTCGCCCGCCTGGCGGTCCTGGCCACCTCGCCCGACGCCAATATCATCAAGCTGCCCAACATCAGCGCCTCGGTGCCCCAGCTGAAAGGCGCGATCGCCGAGCTGCAGGGCCTGGGCTACAAGGTTCCCGACTTCCCGGAAGACCCGCAGACCGACGAAGAGAAAGAGGTTCGCGCACGCTACGCGAAGATCCTCGGCAGCGCCGTGAACCCGGTCCTGCGCGAAGGCAATTCCGACCGTCGCGCGCCTGCCGCAGTGAAGGCCTACGCCCGCAAGCACCCGCACTCCATGGGCAAGTGGAGCATGGCCTCGCGCTCCCACGCCGACTACATGCGCGGCGGCGACTTCTTCTCCAGCGAACAGTCCATCACCATGGCCAAGGCCGGTGACGTGCGCATCGAATTCGTCGGCAAGGACGGCAAGGTCGAGGTCAAGAAG---CAACTGAGCCTGCAGGAAGGCGAAGTGCTCGACAGCATGTTCATGAGCTGCGGCAAGCTGCGCGACTTCTTCGAGAAGACCCTGCAGGACTGCAAGGAAACCGGCGTCATGTGGTCCCTGCACGTCAAGGCGACCATGATGAAGATTTCCCACCCGATCGTCTTCGGACATGCGGTGAGCGTCTACTACAAGGACGTCTTCGACAAGTGGGGCCAACTCTTCGAAGAGCTCGGCGTGAACCCGAACAACGGTATCTCCAGCGTCTACGACAAGATCAAGTCGCTGCCCGCCTCCCAGCAGGAAGAGATCCTCCACGACATCCACGAGGTGTACAGCCACCGCCCGGAAATGGCGATGGTCGACTCCGTGAAAGGCATCACCAACCTGCACATTCCGAGCGACGTCATCGTCGACGCCTCGATGCCGGCGATGATCCGCAACTCCGGCCAGATGTGGGGCAAGGACGGCAAGCAGAAAGACACCAAGGCGGTAATGCCGGAAAGCACCTACGCCCGCATCTACCAGGAGATGATCAACTTCTGCAAGACCAACGGCGCCTTCGACCCGACCACCATGGGCAGCGTGCCGAACGTCGGCCTGATGGCGCAGAAGGCCGAGGAATACGGCTCCCACGACAAGACCTTCGAAATGACCGCCGACGGCACCATGCGCGTGGTC...CTGGCCGACGGCAGCGTGCTGATGCAGCACAAGGTGGAGACCGGCGACATCTGGCGCGCCTGCCAGACCAAGGACGCGCCGATCCGCGACTGGGTCAAGCTGGCCGTCACCCGCGCACGCCAGTCCGATACCCCGGCGATCTTCTGGCTGGACCCGGAGCGCGCCCACGACCGCGAACTGCGCAAGAAGGTCGAGCTGTACCTCAAGGACCACGACCTGACCGGTCTCGACATCAGCATCATGGGCTACAACGAGGCCATTCGCGTCAGCATGGAACGCCTGATCCGCGGCAAGGACACCATCTCGGTGACCGGCAACGTCCTGCGCGACTACCTGACCGACCTGTTCCCGATCATGGAACTGGGCACCTCGGCCAAGATGCTCTCCATCGTTCCGCTGATGGCGGGCGGCGGCATGTACGAAACCGGCGCCGGCGGCTCGGCACCCAAGCACGTCCAGCAACTGGTGGAAGAGAACTACCTGCGCTGGGACTCCCTGGGCGAGTTCCTGGCCCTGGCCGTGTCCCTGGAGGAAACCGGGATCAAGACCGGCAACGCCAAGGCCAAGCTGCTCGGCAAGGCGCTGGACGAAGCCACCGGCAAGCTGCTGGACAACAACAAGTCGCCGTCGCGCAAGGTCGGCGACATCGACAACCGCGGCAGCCACTTCTACCTGGCGATGTACTGGGCCCAGGCCCTGGCCGCCCAGAACGAAGACGCTGAGCTGAAAGCGCACTTCGCACCGCTGGCCAAGGCCCTGACCGAGCAGGAAGCGACCATCGTCGCCGAACTCAATGCGGTCCAGGGCAAGCCGGCCGAGATCGGCGGCTACTATCGCTCCAACCCGGAGCTGACCAGCAAGGTGATGCGCCCCAGCGCCACCTTCAACGCGGCGATCGACAGC
TRN  11011101101011011
//