EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03946 - Ribosomal_L11_N)
FAM  PF03946
PID  Ribosomal_L11_N
DES  Ribosomal protein L11, N-terminal domain
IPR  IPR000911
ANO  13
ALN  61
AID  0.436045
APH  ((((((((RL11_THEMA/7-65:0.12355,RL11_THETH/7-65:0.21671):0.02158,(RL11_BACSU/7-65:0.13265,(RK11_SPIOL/79-137:0.21312,RL11_SYNY3/8-66:0.02069):0.09672):0.06817):0.14078,RL11_STRGR/11-69:0.06594):0.13053,(RL11_LIBAS/7-66:0.35984,RL11_ECOLI/7-66:0.15391):0.02721):0.18663,RM11_CAEEL/22-81:0.68739):0.51482,RL11_SULAC/4-63:0.26732):0.03502,RL11_HALN1/3-61:0.47592):1.36685,RL12_HUMAN/12-70:0.32320,RL12_YEAST/12-70:0.00000);
ATP  ((((((((RL11_THEMA/7-65,RL11_THETH/7-65),(RL11_BACSU/7-65,(RK11_SPIOL/79-137,RL11_SYNY3/8-66))),RL11_STRGR/11-69),(RL11_LIBAS/7-66,RL11_ECOLI/7-66)),RM11_CAEEL/22-81),RL11_SULAC/4-63),RL11_HALN1/3-61),RL12_HUMAN/12-70,RL12_YEAST/12-70);
ATL  5.64708
DNO  13
DLN  183
DID  0.501903
DPH  ((((((RL11_BACSU/7-65:0.19284,((RK11_SPIOL/79-137:0.27211,RL11_SYNY3/8-66:0.13513):0.10017,RL11_THEMA/7-65:0.15949):0.05719):0.06812,(RL11_LIBAS/7-66:0.45519,(RL11_ECOLI/7-66:0.15731,(RL11_STRGR/11-69:0.11547,RL11_THETH/7-65:0.29720):0.16235):0.06811):0.04655):0.08283,RM11_CAEEL/22-81:0.51677):0.29136,RL11_HALN1/3-61:0.41031):0.14389,RL11_SULAC/4-63:0.38640):0.58000,RL12_HUMAN/12-70:0.28859,RL12_YEAST/12-70:0.14184);
DTP  ((((((RL11_BACSU/7-65,((RK11_SPIOL/79-137,RL11_SYNY3/8-66),RL11_THEMA/7-65)),(RL11_LIBAS/7-66,(RL11_ECOLI/7-66,(RL11_STRGR/11-69,RL11_THETH/7-65)))),RM11_CAEEL/22-81),RL11_HALN1/3-61),RL11_SULAC/4-63),RL12_HUMAN/12-70,RL12_YEAST/12-70);
DTL  5.10053
RID  0.436045
RPH  ((((((((RL11_THEMA/7-65:0.12355,RL11_THETH/7-65:0.21671):0.02158,(RL11_BACSU/7-65:0.13265,(RK11_SPIOL/79-137:0.21312,RL11_SYNY3/8-66:0.02069):0.09672):0.06817):0.14078,RL11_STRGR/11-69:0.06594):0.13053,(RL11_LIBAS/7-66:0.35984,RL11_ECOLI/7-66:0.15391):0.02721):0.18663,RM11_CAEEL/22-81:0.68739):0.51482,RL11_SULAC/4-63:0.26732):0.03502,RL11_HALN1/3-61:0.47592):1.36685,RL12_HUMAN/12-70:0.32320,RL12_YEAST/12-70:0.00000);
RTP  ((((((((RL11_THEMA/7-65,RL11_THETH/7-65),(RL11_BACSU/7-65,(RK11_SPIOL/79-137,RL11_SYNY3/8-66))),RL11_STRGR/11-69),(RL11_LIBAS/7-66,RL11_ECOLI/7-66)),RM11_CAEEL/22-81),RL11_SULAC/4-63),RL11_HALN1/3-61),RL12_HUMAN/12-70,RL12_YEAST/12-70);
RTL  5.64708
LNK  RK11_SPIOL/79-137:P31164:X56615
LNK  RL11_BACSU/7-65:Q06796:D13303
LNK  RL11_ECOLI/7-66:P02409:U00006
LNK  RL11_HALN1/3-61:P05969:AE005042
LNK  RL11_LIBAS/7-66:P36250:M94319
LNK  RL11_STRGR/11-69:P36258:X72787
LNK  RL11_SULAC/4-63:P35025:X59038
LNK  RL11_SYNY3/8-66:P36237:X73005
LNK  RL11_THEMA/7-65:P29395:Z11839
LNK  RL11_THETH/7-65:P36238:X81375
LNK  RL12_HUMAN/12-70:P30050:L06505
LNK  RL12_YEAST/12-70:P17079:X51519
LNK  RM11_CAEEL/22-81:P34264:M77697
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxx
NAM  RM11_CAEEL/22-81
ASQ  LLRTNIKAQMASAAPPLGPQLGQRGLNVANFCKEFNKETGHFKQGVPLPTRITVKPD.RTY
DSQ  TTACTCAGAACCAATATTAAAGCACAAATGGCGTCGGCTGCTCCACCACTTGGACCACAACTTGGTCAACGTGGGCTCAATGTCGCGAATTTTTGCAAAGAGTTCAACAAAGAAACAGGCCATTTCAAACAAGGAGTCCCACTTCCCACACGAATCACTGTAAAGCCAGAT...AGAACATAT
TRN  10010101110011010
NAM  RL11_THETH/7-65
ASQ  VVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATAN-MGDAIVPVEITIYAD.RSF
DSQ  GTGGTCAAACTTCAGCTGCCCGCGGGCAAGGCCACGCCCGCGCCCCCGGTGGGCCCGGCTTTGGGCCAGCACGGGGCCAACATCATGGAGTTCGTCAAGGCCTTCAACGCGGCCACGGCCAAC---ATGGGGGACGCCATCGTCCCCGTGGAGATCACCATCTACGCGGAC...CGCTCCTTC
TRN  11011101101011011
NAM  RL11_STRGR/11-69
ASQ  LIKLQINAGAANPAPPVGPALGQHGVNIMEFCKAYNAATES-QRGMVVPVEITVYED.RSF
DSQ  CTTATCAAGCTCCAGATCAACGCCGGTGCGGCGAACCCGGCCCCGCCGGTCGGCCCCGCGCTCGGTCAGCACGGCGTCAACATCATGGAGTTCTGCAAGGCCTACAACGCCGCGACCGAGTCG---CAGCGTGGCATGGTCGTGCCGGTGGAGATCACGGTCTACGAGGAC...CGTTCCTTC
TRN  11011111111111111
NAM  RL11_ECOLI/7-66
ASQ  YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYAD.RSF
DSQ  TATGTCAAGCTGCAGGTTGCAGCTGGTATGGCTAACCCGAGTCCGCCAGTAGGTCCGGCTCTGGGTCAGCAGGGCGTAAACATCATGGAATTCTGCAAAGCGTTCAACGCAAAAACTGATTCCATCGAAAAAGGTCTGCCGATTCCGGTAGTAATCACCGTTTACGCTGAC...CGTTCTTTC
TRN  11011101101011011
NAM  RL11_THEMA/7-65
ASQ  QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETAD-KAGMILPVVITVYED.KSF
DSQ  CAGATTAAATTACAACTGCCTGCCGGAAAAGCCACGCCGGCTCCACCCGTTGGACCCGCCTTGGGTCAGCACGGTGTTAACATCATGGAGTTTTGTAAAAGGTTCAATGCCGAAACAGCGGAT---AAAGCAGGCATGATACTTCCTGTTGTTATCACAGTGTACGAAGAC...AAGTCGTTC
TRN  10010101100011010
NAM  RL11_SYNY3/8-66
ASQ  LIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTAD-KPGMIIPVEISVFED.RSF
DSQ  CTGATTAAACTGGCCCTGCCCGCTGGCAAGGCTAACCCTGCTCCCCCCGTTGGTCCCGCTTTGGGTCAGCATGGGGTTAATATCATGGCATTTTGCAAAGAGTACAATGCCAAGACCGCCGAT---AAGCCTGGGATGATTATTCCTGTGGAAATTTCGGTGTTTGAAGAC...CGTAGTTTC
TRN  11011101101011011
NAM  RK11_SPIOL/79-137
ASQ  VIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTAD-KPGFVIPVEITVFDD.KSF
DSQ  GTAATTAAACTGGCGTTGGAGGCTGGAAAAGCGACACCGGCACCACCAGTGGGACCTGCGCTGGGTTCAAAGGGTGTGAATATAATGGCGTTTTGCAAGGATTATAATGCTAGAACTGCTGAT---AAACCCGGTTTCGTTATTCCTGTTGAGATCACCGTTTTTGATGAT...AAAAGTTTT
TRN  10010101100011001
NAM  RL11_BACSU/7-65
ASQ  VVKLQIPAGKANPAPPVGPALGQAGVNVMGFCKEFNARTAD-QAGLIIPVEISVYED.RSF
DSQ  GTTGTAAAATTGCAAATTCCTGCTGGAAAAGCTAACCCAGCACCACCAGTTGGACCTGCACTTGGTCAAGCCGGTGTTAACGTCATGGGATTCTGTAAGGAGTTTAACGCTCGTACAGCTGAC---CAAGCTGGTTTAATCATTCCTGTTGAAATTTCGGTTTACGAAGAC...CGTTCATTT
TRN  11011101111011000
NAM  RL11_LIBAS/7-66
ASQ  IVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKD.KSF
DSQ  ATAGTTAAGTTGCAGATAGAGTCGGGTTCTGCAAAGCCTTCGCCGCCGGTTGGTCCTGCAATTGGACAGGCTGGTATTCCCATTATGGCGTTTTGTAAGGCGTTTAATGCGGCAACTGAGGGTATGGAAAAGGGTATTCCCATCCCAACTACTGTGACTTGTTATAAAGAT...AAGTCTTTT
TRN  10010101110011011
NAM  RL11_SULAC/4-63
ASQ  TIKIMVEGGSAKPGPPLGPTLSQLGLNVQEVVKKINDVTAQ-FKGMSVPVTIEIDSStKKY
DSQ  ACAATAAAAATAATGGTAGAAGGAGGTAGTGCTAAACCAGGTCCACCATTGGGACCTACCCTATCACAATTAGGACTTAATGTTCAGGAAGTTGTTAAAAAAATAAATGATGTTACAGCACAA---TTTAAAGGAATGTCAGTACCAGTCACAATTGAGATCGATAGTTCAactAAAAAATAT
TRN  10010101110011000
NAM  RL11_HALN1/3-61
ASQ  TIEVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTEA-FDGTEVPVTIEYEDD.GSF
DSQ  ACGATCGAAGTGCTCGTTGCCGGTGGGCAGGCCGACCCTGGCCCGCCCCTCGGTCCCGAGCTCGGTCCCACGCCGGTCGACGTACAGGCGGTCGTCCAGGAGATCAACGACCAGACCGAAGCG---TTCGACGGGACGGAGGTCCCGGTCACCATCGAATACGAGGACGAC...GGCTCGTTC
TRN  11011111111111111
NAM  RL12_YEAST/12-70
ASQ  YLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKE-FKGIKVTVQLKIQNR.QAA
DSQ  TACTTGTACCTAAGAGCCGTTGGTGGTGAAGTCGGTGCCTCCGCTGCTTTGGCTCCAAAGATTGGTCCTTTAGGTCTATCGCCAAAGAAGGTTGGTGAAGATATTGCTAAGGCCACCAAAGAA---TTCAAGGGTATCAAGGTTACCGTCCAATTAAAGATCCAAAACAGA...CAAGCTGCT
TRN  10010101110011010
NAM  RL12_HUMAN/12-70
ASQ  VVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGD-WKGLRITVKLTIQNR.QAQ
DSQ  GTCGTATACCTGAGGTGCACCGGAGGTGAAGTCGGTGCCACTTCTGCCCTGGCCCCCAAGATCGGCCCCCTGGGTCTGTCTCCAAAAAAAGTTGGTGATGACATTGCCAAGGCAACGGGTGAC---TGGAAGGGCCTGAGGATTACAGTGAAACTGACCATTCAGAACAGA...CAGGCCCAG
TRN  10010101100011011
//