EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03939 - Ribosomal_L23eN)
FAM  PF03939
PID  Ribosomal_L23eN
DES  Ribosomal protein L23, N-terminal domain
IPR  IPR005633
ANO  4
ALN  58
AID  0.319606
APH  ((RL25_KLULA/1-54:0.55555,R23A1_CAEEL/6-59:0.67100):0.29185,RL23A_TRYBB/13-70:2.37370,RL23A_TOBAC/12-66:0.41124);
ATP  ((RL25_KLULA/1-54,R23A1_CAEEL/6-59),RL23A_TRYBB/13-70,RL23A_TOBAC/12-66);
ATL  4.30334
DNO  4
DLN  174
DID  0.401141
DPH  ((RL25_KLULA/1-54:0.23029,R23A1_CAEEL/6-59:0.66061):0.19142,RL23A_TRYBB/13-70:1.06127,RL23A_TOBAC/12-66:0.43904);
DTP  ((RL25_KLULA/1-54,R23A1_CAEEL/6-59),RL23A_TRYBB/13-70,RL23A_TOBAC/12-66);
DTL  2.58263
RID  0.319606
RPH  ((RL25_KLULA/1-54:0.55555,R23A1_CAEEL/6-59:0.67100):0.29185,RL23A_TRYBB/13-70:2.37370,RL23A_TOBAC/12-66:0.41124);
RTP  ((RL25_KLULA/1-54,R23A1_CAEEL/6-59),RL23A_TRYBB/13-70,RL23A_TOBAC/12-66);
RTL  4.30334
LNK  R23A1_CAEEL/6-59:P48162:U40948
LNK  RL23A_TOBAC/12-66:Q07761:L18908
LNK  RL23A_TRYBB/13-70:P41165:L21172
LNK  RL25_KLULA/1-54:P48045:S53176
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RL23A_TOBAC/12-66
ASQ  SDPKAQAAKVAKAVKSGSTLKKKSQKIRTKVTFHRPKTLKKDRNP---KYPRISAPGR
DSQ  TCTGACCCCAAGGCACAGGCAGCTAAGGTTGCCAAGGCTGTCAAGTCAGGATCAACCTTGAAGAAAAAGTCACAAAAGATAAGGACAAAAGTTACATTCCACCGACCTAAGACTTTGAAGAAGGATAGAAACCCC---------AAGTACCCTCGTATTAGTGCACCTGGAAGG
TRN  10010101110011001
NAM  RL25_KLULA/1-54
ASQ  MAPSTKATAAKKAVVKG-TNGKKALKVRTSASFRLPKTLKLARSP---KYATKAVPHY
DSQ  ATGGCTCCATCTACTAAGGCTACTGCTGCTAAGAAGGCTGTTGTTAAGGGT---ACCAATGGTAAGAAGGCTTTGAAGGTCAGAACCTCTGCTTCCTTCAGATTGCCAAAGACCTTGAAGTTGGCTAGATCTCCA---------AAGTACGCTACCAAGGCTGTCCCACACTAC
TRN  10110101110011011
NAM  R23A1_CAEEL/6-59
ASQ  PAKTAKALDAKKKVVKG-KRTTHRRQVRTSVHFRRPVTLKTARQA---RFPRKSAPKT
DSQ  CCAGCTAAGACTGCCAAGGCTCTCGACGCCAAGAAGAAGGTCGTCAAGGGA---AAACGCACCACCCACAGACGTCAAGTCCGCACCTCCGTGCACTTCCGTCGCCCGGTCACCCTCAAGACCGCCCGTCAGGCT---------CGTTTCCCACGCAAGTCTGCCCCAAAGACC
TRN  10010101110011011
NAM  RL23A_TRYBB/13-70
ASQ  KNSAPKSAVSKKVAKKGAPAAAAKPTKVVKVTKRKAYTRPQFRRPHTYRRPATVKPSS
DSQ  AAGAACAGTGCGCCTAAGAGCGCTGTTTCGAAAAAGGTGGCCAAGAAGGGTGCGCCTGCTGCTGCTGCGAAACCCACGAAAGTGGTGAAGGTAACGAAACGCAAGGCATACACCCGTCCGCAGTTTCGCCGCCCGCACACGTACCGCAGGCCTGCGACCGTGAAACCCAGCAGC
TRN  10110101110011011
//