EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03923 - Lipoprotein_16)
FAM  PF03923
PID  Lipoprotein_16
DES  Uncharacterized lipoprotein
IPR  IPR005619
ANO  2
ALN  207
AID  0.27439
APH  (YAJG_HAEIN/1-199:1.21247,Q9KPR8_VIBCH/3-205:0.51182);
ATP  (YAJG_HAEIN/1-199,Q9KPR8_VIBCH/3-205);
ATL  1.7243
DNO  2
DLN  621
DID  0.422222
DPH  (YAJG_HAEIN/1-199:0.61076,Q9KPR8_VIBCH/3-205:0.52903);
DTP  (YAJG_HAEIN/1-199,Q9KPR8_VIBCH/3-205);
DTL  1.13979
RID  0.27439
RPH  (YAJG_HAEIN/1-199:1.21247,Q9KPR8_VIBCH/3-205:0.51182);
RTP  (YAJG_HAEIN/1-199,Q9KPR8_VIBCH/3-205);
RTL  1.7243
LNK  Q9KPR8_VIBCH/3-205:Q9KPR8:AE004300
LNK  YAJG_HAEIN/1-199:P43782:U20229
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YAJG_HAEIN/1-199
ASQ  MALVNKIK----TLSSVGILAATLFLAGCQA-QSNILAFTPPAP-SASMNVNRTAVVSVTTKDSRAIQEIASYTKHGELIKLNASP--SVTQLFQQVMQQNLISKGFRVGQLNGSNAWVTVDVREFGTQVEQGNLRYKLNTKIQATVYVQGAKGSYNKSFNVTHSQEGVFNAGNDEIHKVLSQTFNDIVNNIYQDQEVAAAINQYSN
DSQ  ATGGCATTAGTAAACAAAATTAAA------------ACATTATCATCAGTAGGTATTCTAGCGGCTACATTATTTCTTGCAGGCTGCCAAGCA---CAATCAAATATATTAGCATTTACGCCGCCTGCACCA---AGTGCTTCAATGAATGTTAATCGAACTGCCGTTGTATCTGTGACAACAAAAGATAGCCGTGCAATACAAGAGATTGCGAGTTATACGAAACACGGGGAACTGATTAAATTAAATGCATCCCCA------AGTGTTACACAATTATTTCAGCAAGTGATGCAGCAAAATTTAATTAGTAAAGGTTTTAGAGTTGGGCAATTAAATGGTTCAAATGCGTGGGTAACTGTGGATGTGCGTGAATTTGGTACGCAAGTAGAACAAGGTAATCTTCGTTATAAACTTAATACCAAAATTCAAGCGACAGTTTATGTACAAGGTGCGAAAGGTTCGTATAATAAATCATTTAATGTCACGCACTCACAAGAGGGCGTATTTAATGCGGGCAATGATGAAATTCATAAAGTGCTATCTCAAACTTTTAATGATATTGTGAACAATATTTATCAAGATCAAGAAGTTGCGGCTGCGATAAACCAATATTCTAAT
TRN  10010101100011000
NAM  Q9KPR8_VIBCH/3-205
ASQ  LAAVCTIKRKELTMKKLVLAASIALLTACSAPQQSQINVNPQAALSQNAIVN-NSSFSLVSKDVRSAQYVA-LVDSGRNNIEPIHPRQNVRITLENALAEQFGSQGFRLS-VNSENT-ITLEIQELLVSVKHSIMENQMDGSVVLEITAETPRGKLVKSYTGTAKRTGVLSASNDEIETVLNDVINTVLKEIANDAELQNYMQERFN
DSQ  CTTGCGGCTGTGTGCACAATAAAACGAAAGGAATTAACCATGAAAAAACTGGTTCTTGCGGCTTCAATCGCTTTACTTACCGCTTGTTCTGCTCCTCAGCAGAGTCAAATCAACGTTAACCCTCAAGCGGCATTAAGCCAAAATGCGATTGTGAAT---AACAGCAGCTTTTCGCTGGTCAGCAAAGATGTGCGTTCAGCGCAATATGTGGCT---TTAGTCGATAGTGGTCGTAACAATATTGAGCCCATTCATCCACGCCAAAATGTGCGCATTACGCTAGAAAACGCCCTGGCTGAACAGTTTGGATCGCAAGGTTTCCGTCTCAGC---GTCAATAGTGAAAACACC---ATCACTCTCGAAATCCAAGAACTTTTGGTCTCCGTGAAGCACTCAATCATGGAAAACCAAATGGATGGCAGCGTGGTATTGGAAATCACGGCTGAAACACCAAGAGGCAAGTTGGTGAAAAGCTACACAGGCACCGCAAAACGTACTGGCGTTCTCAGTGCCTCTAACGATGAAATTGAAACCGTACTCAATGACGTGATCAACACTGTGCTCAAAGAGATCGCTAACGATGCCGAGCTGCAAAACTACATGCAGGAGCGCTTTAAT
TRN  10010101100011000
//