EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03886 - DUF330)
FAM  PF03886
PID  DUF330
DES  Protein of unknown function (DUF330)
IPR  IPR005586
ANO  4
ALN  182
AID  0.234527
APH  ((YMBA_ECOLI/1-176:0.67645,Q9JYA5_NEIMB/5-172:1.02909):0.16574,Q9KR87_VIBCH/6-187:1.01282,Q9HUK2_PSEAE/11-187:1.44629);
ATP  ((YMBA_ECOLI/1-176,Q9JYA5_NEIMB/5-172),Q9KR87_VIBCH/6-187,Q9HUK2_PSEAE/11-187);
ATL  4.33039
DNO  4
DLN  546
DID  0.38259
DPH  ((YMBA_ECOLI/1-176:24.56059,Q9KR87_VIBCH/6-187:57.59086):15.44170,Q9HUK2_PSEAE/11-187:63.85474,Q9JYA5_NEIMB/5-172:43.35242);
DTP  ((YMBA_ECOLI/1-176,Q9KR87_VIBCH/6-187),Q9HUK2_PSEAE/11-187,Q9JYA5_NEIMB/5-172);
DTL  221.586
RID  0.234527
RPH  ((YMBA_ECOLI/1-176:0.67645,Q9JYA5_NEIMB/5-172:1.02909):0.16574,Q9KR87_VIBCH/6-187:1.01282,Q9HUK2_PSEAE/11-187:1.44629);
RTP  ((YMBA_ECOLI/1-176,Q9JYA5_NEIMB/5-172),Q9KR87_VIBCH/6-187,Q9HUK2_PSEAE/11-187);
RTL  4.33039
LNK  Q9HUK2_PSEAE/11-187:Q9HUK2:AE004909
LNK  Q9JYA5_NEIMB/5-172:Q9JYA5:AE002517
LNK  Q9KR87_VIBCH/6-187:Q9KR87:AE004252
LNK  YMBA_ECOLI/1-176:P75866:U00096
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9JYA5_NEIMB/5-172
ASQ  PIAAALSLAACGTVQSTQ--YFVLPDSR--YIRPATQGG-ETAVEVRLAEPLKRG-GLVYQTDPYRLNTAQNHVWADTLDDMLEAALSNAFNRLDSTRIFVPASRSGSTEK---WTVYIDAFQGSYTGKTLISG-YAVLPDG----TNRPFHIETEQQGDGYAAMTAALEQGLKQAAQQMVE
DSQ  CCGATTGCCGCCGCCCTGTCGCTTGCCGCCTGCGGTACTGTGCAAAGCACACAA------TATTTCGTGTTGCCCGACAGCCGC------TACATCCGTCCTGCAACGCAAGGCGGC---GAAACTGCCGTCGAAGTCCGTCTTGCCGAACCGCTCAAACGCGGC---GGACTGGTCTATCAAACCGACCCCTACCGCCTCAACACCGCACAAAACCACGTCTGGGCAGACACCTTGGACGATATGCTCGAAGCGGCGTTGAGCAATGCATTCAACCGTTTGGACAGCACACGCATCTTTGTTCCTGCCTCACGCAGCGGCAGTACCGAAAAA---------TGGACGGTCTATATCGACGCATTCCAAGGCAGCTACACGGGCAAAACCCTCATCAGCGGC---TACGCCGTCCTACCCGACGGT------------ACGAACAGACCCTTCCATATCGAAACCGAACAGCAGGGTGACGGCTACGCCGCGATGACCGCCGCACTCGAACAGGGACTGAAACAGGCGGCGCAACAGATGGTCGAG
TRN  10010101100011001
NAM  YMBA_ECOLI/1-176
ASQ  MTIAALWLAGCSSGEINKN-YYQLPVVQSGTQSTASQGNRLLWVEQVTVPDYLAGNGVVYQTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQDT---LNVTVTEFNGRYDGKVIVSGEWLLNHQGQ--LIKRPFRLEGVQTQDGYDEMVKVLAGVWSQEAASIAQ
DSQ  GTGACGATTGCAGCACTGTGGCTGGCCGGATGCAGCTCCGGCGAAATTAATAAAAAC---TATTACCAGTTACCTGTGGTGCAGAGCGGTACACAAAGTACCGCCAGCCAGGGCAATCGTCTGTTATGGGTAGAGCAGGTCACTGTTCCTGACTATCTGGCGGGGAATGGTGTGGTTTATCAAACCAGTGATGTGAAGTATGTGATTGCCAACAACAACTTGTGGGCCAGCCCGTTGGATCAACAGTTGCGCAACACCCTGGTTGCCAACCTGAGTACGCAACTGCCCGGCTGGGTGGTTGCCTCCCAGCCTCTGGGAAGCGCCCAGGACACG---------CTCAATGTTACCGTAACGGAGTTTAACGGTCGCTATGATGGCAAGGTCATTGTCAGTGGTGAGTGGCTGTTGAACCACCAGGGACAA------CTGATCAAACGTCCGTTCCGTCTGGAAGGAGTGCAAACTCAGGATGGTTACGATGAGATGGTTAAAGTGCTGGCCGGTGTCTGGAGTCAGGAAGCCGCTTCTATTGCACAA
TRN  11011101101011010
NAM  Q9KR87_VIBCH/6-187
ASQ  LMMLTTLLVGCGGTPQPKVSFYLLPNNPELSEHIQPKTLPLLVVQPVELAAYLDTQGIVYRQSETQVIQARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPLNASSIQQEHWKLQVRLQRFNGVYTGNAEVAGNWELLNPKGESMLNQEFSFQVPLKDTGYPALVEALSAGVDQLSTQIET
DSQ  TTGATGATGTTAACCACACTGTTGGTCGGCTGCGGAGGAACGCCACAGCCCAAAGTCAGTTTTTATTTACTGCCAAACAACCCAGAACTTAGCGAGCATATCCAGCCCAAAACATTGCCTTTGCTGGTGGTTCAACCCGTGGAATTGGCGGCTTATCTAGATACGCAAGGGATTGTTTATCGTCAGTCGGAAACGCAAGTGATCCAAGCCAGACAAAACCAGTGGGCACAGCGGCTTAGCCCACAACTGACACAACGTATCACCAATGATCTGCGCCGTAAGCAATCTCGCTACTGGCCTGCACCTTTGAATGCTTCATCCATCCAGCAAGAGCACTGGAAACTACAGGTAAGATTGCAGCGATTTAATGGTGTCTACACGGGCAATGCCGAAGTGGCTGGCAATTGGGAACTGCTCAACCCAAAAGGAGAAAGCATGTTAAACCAAGAGTTTAGTTTTCAGGTGCCGCTCAAAGATACGGGTTACCCCGCTCTGGTTGAAGCACTCTCTGCGGGTGTAGATCAACTTTCAACTCAGATCGAAACC
TRN  10010101100011000
NAM  Q9HUK2_PSEAE/11-187
ASQ  SLVSLLGLTGCAVHPPAQ--LYQLDVGA--AAVPKKDGGAAVLLGPVQLADYLKRDVMVQRQADGILSLSTDARWAGNLETNVSQQLLRQMSSELGSSRLALFPEKPGFTPQVQVMLTISRLDSGPKQPAVIEARWRLLDQKGDLKDSRVFHEE-EQHQGSIGDQIRAQSDLLKRLAAQLAK
DSQ  TCCCTCGTCAGCCTGCTCGGGCTGACGGGTTGTGCGGTCCATCCGCCGGCCCAG------CTCTACCAGTTGGACGTCGGTGCC------GCCGCAGTACCGAAAAAGGATGGCGGTGCGGCCGTCCTGCTCGGCCCGGTACAACTGGCCGACTATCTCAAGCGCGATGTGATGGTGCAGCGGCAGGCCGACGGTATTCTCAGCCTGTCCACCGACGCGCGCTGGGCCGGCAACCTGGAGACCAATGTCAGCCAGCAACTGCTGCGGCAGATGTCCAGCGAGCTGGGCAGCAGCCGCCTGGCGCTGTTCCCGGAAAAACCCGGTTTCACCCCCCAGGTCCAGGTGATGCTGACCATCAGTCGCCTCGACTCCGGCCCCAAGCAGCCGGCAGTGATCGAGGCGCGCTGGCGCCTGTTGGACCAGAAGGGCGACCTGAAGGACAGCCGGGTGTTCCACGAGGAA---GAACAGCATCAGGGCAGCATCGGCGACCAGATCCGTGCCCAGAGCGACCTGCTCAAGCGCCTGGCGGCGCAGTTGGCCAAG
TRN  11011101101011011
//