EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03884 - DUF329)
FAM  PF03884
PID  DUF329
DES  Domain of unknown function (DUF329)
IPR  IPR005584
ANO  8
ALN  65
AID  0.426892
APH  (Y891_HAEIN/2-61:0.26843,Y089_PASMU/6-65:0.16745,((Y4530_PSEAE/5-64:0.23713,(Y330_NEIMB/5-69:0.55233,(Y2340_CAUCR/1-57:0.40618,Y6451_RHILO/10-65:0.58231):0.53933):0.19820):0.42615,(Y2429_VIBCH/5-65:0.37805,YACG_ECOLI/5-64:0.18748):0.16276):0.24639);
ATP  (Y891_HAEIN/2-61,Y089_PASMU/6-65,((Y4530_PSEAE/5-64,(Y330_NEIMB/5-69,(Y2340_CAUCR/1-57,Y6451_RHILO/10-65))),(Y2429_VIBCH/5-65,YACG_ECOLI/5-64)));
ATL  4.35222
DNO  6
DLN  195
DID  0.479615
DPH  (Y4530_PSEAE/5-64:0.11187,(Y330_NEIMB/5-69:0.36464,(Y2429_VIBCH/5-65:0.33029,YACG_ECOLI/5-64:0.20343):0.39579):0.11313,(Y2340_CAUCR/1-57:0.31178,Y6451_RHILO/10-65:0.28506):0.39701);
DTP  (Y4530_PSEAE/5-64,(Y330_NEIMB/5-69,(Y2429_VIBCH/5-65,YACG_ECOLI/5-64)),(Y2340_CAUCR/1-57,Y6451_RHILO/10-65));
DTL  2.513
RID  0.403316
RPH  (((Y4530_PSEAE/5-64:0.27340,(Y2429_VIBCH/5-65:0.35133,YACG_ECOLI/5-64:0.21007):0.55576):0.19069,Y330_NEIMB/5-69:0.48971):0.61868,Y2340_CAUCR/1-57:0.40211,Y6451_RHILO/10-65:0.57805);
RTP  (((Y4530_PSEAE/5-64,(Y2429_VIBCH/5-65,YACG_ECOLI/5-64)),Y330_NEIMB/5-69),Y2340_CAUCR/1-57,Y6451_RHILO/10-65);
RTL  3.66982
LNK  Y089_PASMU/6-65:Q9CPF4:
LNK  Y2340_CAUCR/1-57:Q9A5V7:AE005904
LNK  Y2429_VIBCH/5-65:Q9KPE1:AE004312
LNK  Y330_NEIMB/5-69:Q9K155:AE002390
LNK  Y4530_PSEAE/5-64:Q9HVP7:AE004867
LNK  Y6451_RHILO/10-65:Q989F2:AP003009
LNK  Y891_HAEIN/2-61:P44921:
LNK  YACG_ECOLI/5-64:P36681:U00096
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y891_HAEIN/2-61
ASQ  IEVP----CPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTA-DFAMDPNVSDEW
NAM  Y089_PASMU/6-65
ASQ  FSVP----CPICQKQVEWSDKSPFRPFCCKRCQLIDLGEWAAEEKAIPCESA-DFAMNDEQEDWR
NAM  YACG_ECOLI/5-64
ASQ  ITVN----CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD-LSESDDWSEEPK
DSQ  ATTACGGTGAAT------------TGCCCAACCTGCGGGAAAACGGTGGTGTGGGGTGAAATCAGCCCGTTTCGGCCATTTTGCTCCAAACGTTGTCAGCTGATCGACCTCGGAGAATGGGCTGCTGAAGAAAAACGAATCCCCAGCAGTGGCGAT---CTTTCCGAAAGCGATGACTGGAGCGAAGAACCAAAG
TRN  11011101101011011
NAM  Y2429_VIBCH/5-65
ASQ  LTIVK---CPRCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPD-MSDSDGWSEDQY
DSQ  CTCACCATAGTGAAA---------TGCCCACGATGTGGCACCGATGTGGAATGGGGCGAACAGAGCCCACACCGTCCATTTTGCAGTAAGCAGTGTCAAATGATTGATTTTGGTGAATGGGCAGATGAAGAGAAAGCCATTCCCGGCGCACCGGAT---ATGTCCGACAGCGATGGCTGGTCAGAAGATCAGTAT
TRN  10010101110011001
NAM  Y4530_PSEAE/5-64
ASQ  LTVE----CPTCGAPVEWKSDNKYRPFCSDRCKLIDLGAWAAEEHAIPGDTL-EDDIFSADLPPR
DSQ  CTGACCGTGGAG------------TGCCCGACCTGCGGCGCGCCCGTCGAATGGAAAAGCGACAACAAGTACCGCCCCTTCTGCTCCGACCGCTGCAAGCTGATCGATCTCGGCGCCTGGGCCGCCGAGGAACATGCGATCCCCGGCGACACCCTG---GAAGACGACATCTTCTCCGCCGACCTGCCGCCTCGC
TRN  11011101101011011
NAM  Y330_NEIMB/5-69
ASQ  RQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPEISEPDMAYR
DSQ  CGGCAAACACGCCTTCAAGTCAAATGTCCGACCTGTCAAACAGCAGTAGTATGGAAACCCGAAAACGCATTCCGCCCCTTCTGTTCGCAACGCTGCAAACTGATCGACTTGGGCGGATGGGCAGACGGGAAATATACGGTTTCCGGCCAAACGGAAAGTTTGCCGGAAATATCCGAACCCGACATGGCATACCGC
TRN  10010101100011011
NAM  Y6451_RHILO/10-65
ASQ  LRPKRP--CPECGKPSAR----DTFPFCSARCKDIDLNRWLKGAYVIKARDDEEE--PDADEPK-
DSQ  CTGCGGCCAAAGCGCCCC------TGCCCCGAATGCGGCAAGCCGTCGGCGCGC------------GACACCTTTCCGTTCTGCTCGGCCCGCTGCAAGGACATCGACCTCAACCGCTGGCTGAAGGGCGCCTATGTCATCAAGGCCCGCGACGACGAGGAAGAA------CCCGACGCCGACGAGCCCAAG---
TRN  11011111101111111
NAM  Y2340_CAUCR/1-57
ASQ  MSAK----CPICAKPVDS----AFRPFCSKRCADVDLQRWLSGRYVVAGGDDDEENPPSQDINRE
DSQ  ATGAGCGCGAAA------------TGTCCCATCTGCGCCAAGCCCGTTGATTCC------------GCGTTCCGCCCTTTCTGTTCGAAACGCTGCGCGGACGTGGATCTCCAGCGCTGGCTGAGCGGTCGCTACGTCGTGGCGGGTGGGGACGACGATGAAGAAAATCCGCCATCCCAAGACATCAACAGGGAA
TRN  10010101100011011
//