EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03882 - KicB)
FAM  PF03882
PID  KicB
DES  KicB killing factor
IPR  IPR005582
ANO  3
ALN  449
AID  0.643165
APH  (MUKF_VIBCH/1-445:0.35174,MUKF_SHIFL/1-440:0.19972,MUKF_HAEIN/1-444:0.24260);
ATP  (MUKF_VIBCH/1-445,MUKF_SHIFL/1-440,MUKF_HAEIN/1-444);
ATL  0.79406
DNO  2
DLN  1347
DID  0.629545
DPH  (MUKF_VIBCH/1-445:0.01163,MUKF_SHIFL/1-440:0.50356);
DTP  (MUKF_VIBCH/1-445,MUKF_SHIFL/1-440);
DTL  0.51518
RID  0.624402
RPH  (MUKF_VIBCH/1-445:0.38199,MUKF_SHIFL/1-440:0.14636);
RTP  (MUKF_VIBCH/1-445,MUKF_SHIFL/1-440);
RTL  0.52835
LNK  MUKF_HAEIN/1-444:P45185:
LNK  MUKF_SHIFL/1-440:P60294:AE015121
LNK  MUKF_VIBCH/1-445:Q9KRC6:AE004249
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MUKF_VIBCH/1-445
ASQ  MSEFTQDTVQKPIDELVTWVKQYDFSLNLPTERLAFLLAIAVLSNERFDEELGEGELHDAFAIVTRLFAESGEASAFRANNAINDLVKQRLLSRFTSEMTEGASIYRLTPLAIGITDYYVRHREFSKLKLSIQLSMVADEMAKAVESAQQGGS----VAHWRKNVFGVLKYSVSEIFDRIDLNQRVMDEQQQSVKEQIADLLNKDWRDAINNCEALLSETSATLRELQDTLQAAGDELQTQILDIQECVYGDLELDFIEETLSALQMKLDRITSWGQQSIDLWIGYDRHVHKFIRTAIDMDQNRAFSQRLRQSMNDYFEQPWYLTYADAERLSDLRDETLTLRDEEVTGHVPTEVEYEELQQVNDELAQRIGDMLKVHKEQGAAIDLALVLRDYLASHPRTHHFDLARMVVDQAVRLGYSESDYRAIQPDWTAINDFGAKVQANVIDRY
DSQ  ATGAGTGAGTTTACTCAGGATACTGTGCAAAAGCCCATCGACGAACTCGTCACTTGGGTAAAACAGTATGACTTCTCATTGAATCTGCCTACTGAGCGGCTGGCATTTTTGCTCGCGATTGCTGTGCTCAGTAATGAAAGATTTGATGAAGAGCTCGGAGAAGGGGAACTTCACGATGCATTCGCGATAGTCACGCGCTTGTTTGCAGAATCGGGAGAAGCCTCAGCCTTTCGGGCTAACAATGCGATTAATGATCTGGTCAAACAGCGCTTACTAAGCCGCTTTACCAGCGAAATGACGGAAGGTGCCAGCATCTACCGTTTGACCCCTTTAGCGATCGGCATTACCGATTACTATGTTCGTCATCGCGAATTTTCCAAACTGAAACTATCCATCCAACTCTCTATGGTCGCGGATGAGATGGCGAAAGCCGTGGAATCGGCGCAGCAGGGTGGCAGT------------GTCGCCCATTGGCGCAAAAACGTGTTTGGCGTGCTCAAATATTCGGTGAGTGAAATCTTCGATCGCATCGACCTTAACCAGCGTGTGATGGATGAGCAGCAGCAATCGGTCAAAGAGCAGATTGCGGATCTGCTGAATAAAGATTGGCGCGATGCGATCAACAACTGTGAAGCCTTGCTGTCTGAGACTTCCGCCACACTGCGTGAGCTGCAAGATACCTTGCAAGCGGCAGGCGATGAGTTGCAAACGCAAATCCTCGATATTCAGGAGTGCGTGTATGGCGATCTGGAATTGGATTTCATCGAAGAGACGCTGTCTGCGCTGCAAATGAAGCTCGACCGCATTACGAGCTGGGGTCAGCAGTCGATTGATCTTTGGATTGGTTACGATCGCCACGTCCACAAGTTTATTCGTACCGCGATTGATATGGACCAGAACCGCGCGTTCAGCCAACGTCTGCGTCAGTCAATGAACGACTATTTTGAACAACCTTGGTATCTCACTTACGCCGATGCAGAACGTCTATCCGATCTGCGTGATGAAACCTTGACCCTGCGTGACGAAGAAGTTACCGGTCATGTGCCGACAGAAGTGGAATACGAAGAGCTGCAACAAGTGAACGATGAACTTGCGCAGCGGATTGGCGACATGCTGAAAGTGCATAAAGAGCAGGGCGCAGCAATTGATTTAGCACTTGTGCTGCGTGATTACCTAGCTAGCCATCCACGAACCCATCATTTCGATTTAGCCCGAATGGTTGTCGACCAAGCGGTAAGACTGGGTTACTCCGAGTCCGACTACCGCGCTATCCAGCCTGACTGGACGGCGATCAACGATTTTGGCGCAAAGGTACAAGCGAATGTCATCGACCGATAT
TRN  10010101100011000
NAM  MUKF_SHIFL/1-440
ASQ  MSEFSQT-----VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGD----EFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMRDEEMALRDEEVTGELPEDLEYEEFNEIREQLAAIIEEQLAVYKTRQVPLDLGLVVREYLSQYPRARHFDVARIVIDQAVRLGVAQADFTGLPAKWQPINDYGAKVQAHVIDKY
DSQ  ATGAGTGAATTTTCCCAGACA---------------GTCCCCGAACTGGTTGCCTGGGCCAGAAAAAATGACTTCTCCATCTCGCTGCCGGTAGACCGACTCTCTTTTCTGCTGGCGGTTGCCACGCTGAACGGCGAGCGTCTGGATGGTGAGATGAGTGAAGGCGAGCTGGTGGATGCATTCCGCCATGTGAGTGATGCGTTTGAGCAAACCAGCGAAACCATCGGCGTGCGCGCCAATAACGCGATCAACGACATGGTGCGTCAACGTCTGCTGAACCGCTTTACCAGCGAGCAGGCGGAAGGGAACGCAATTTACCGTCTGACGCCGCTCGGCATCGGCATTACTGACTACTACATCCGTCAGCGCGAGTTTTCTACGCTGCGTCTTTCTATGCAGTTGTCGATTGTGGCGGGTGAGCTCAAACGCGCAGCAGATGCCGCCGAAGAGGGCGGTGAT------------GAATTTCACTGGCACCGTAATGTCTATGCGCCACTGAAATATTCGGTAGCAGAAATTTTCGACAGTATCGACCTGACGCAACGTCTGATGGACGAACAGCAGCAGCAGGTGAAGGACGATATCGCCCAGTTGCTGAACAAAGACTGGCGGGCGGCGATTTCCAGCTGTGAATTGTTGCTTTCGGAAACTTCCGGAACGCTGCGTGAATTGCAGGATACGCTGGAAGCGGCAGGCGACAAATTGCAGGCTAATCTGTTGCGCATTCAGGATGCGACGATGACCCATGACGATCTGCATTTCGTCGATCGTCTGGTGTTCGATCTGCAGAGCAAACTCGATCGTATTATCAGTTGGGGCCAGCAATCCATCGACTTGTGGATTGGCTACGACCGCCACGTACACAAATTTATTCGTACCGCGATCGATATGGATAAAAACCGCGTCTTTGCTCAGCGGTTACGTCAGTCGGTACAAACCTATTTTGATGAGCCGTGGGCGCTAACTTATGCCAATGCCGATCGTCTGCTGGATATGCGTGACGAAGAGATGGCACTGCGCGATGAAGAAGTGACTGGGGAACTTCCTGAGGATCTGGAATACGAAGAGTTTAACGAGATCCGCGAACAGCTGGCGGCGATCATCGAAGAACAACTTGCCGTGTACAAAACTAGACAAGTGCCGCTGGATCTTGGTCTGGTGGTACGCGAATATCTGTCACAGTATCCGCGTGCACGTCACTTTGACGTTGCGCGTATTGTTATTGATCAGGCGGTACGTCTTGGCGTAGCGCAAGCAGATTTCACCGGACTGCCAGCGAAATGGCAGCCGATTAATGATTACGGAGCCAAGGTACAGGCGCATGTCATCGACAAATAT
TRN  10010101100011000
NAM  MUKF_HAEIN/1-444
ASQ  MIETSQT-----IPELVSWAKDREFSLNLPTERLVFLLAIAIYNNERLDGEMLEADLVDIFRHTMNAFEQSTDAIATRANNAINELVKQRLLNRFSSEFTEGLAIYRLTPLGVGVSDYYIRQREFSALRLSVQLSIVADEIQRASDSAEEGVENNENEHYWRRNVFAPLKYSVAEIFDSIDLSQRIMDENQQSIKDEIAELLTKDWQAAISSCERLLDETSGNLRELQDTLNAAGDKLQAQLLRIQDCVIGRDDLYFIDQLITDLQSKLDRIISWGQQAIDLWIGYDRHVHKFIRTAIDMDKNRVFSQRLRNSIHHYFDHPWFLWTAQAERLVDLRDEEMVLREDDALGELPEELQYESLSDLHDQIVEHMQGLLIAYRENNRPIDLSLVLKEQLENYPLSRHFDVARIIVDQAVRLGMANDDLSGIYPDWQAINKRGAEVQAHVIDKY
//