EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03873 - RseA_C)
FAM  PF03873
PID  RseA_C
DES  Anti sigma-E protein RseA, C-terminal domain
IPR  IPR005573
ANO  8
ALN  67
AID  0.233579
APH  (Q9KPA7_VIBCH/142-208:0.16883,(RSEA_ECOLI/131-197:1.49356,(RSEA_HAEIN/130-195:0.06408,Q9CK46_PASMU/130-195:0.45888):0.40665):0.56629,(((Q9RCH7_AZOVI/113-171:0.42239,Q9AQD3_PSESY/113-172:0.46152):0.08351,MUCA_PSEAE/113-170:0.50006):2.26909,Q52554_PHOPR/154-206:0.00000):0.86597);
ATP  (Q9KPA7_VIBCH/142-208,(RSEA_ECOLI/131-197,(RSEA_HAEIN/130-195,Q9CK46_PASMU/130-195)),(((Q9RCH7_AZOVI/113-171,Q9AQD3_PSESY/113-172),MUCA_PSEAE/113-170),Q52554_PHOPR/154-206));
ATL  7.76083
DNO  8
DLN  201
DID  0.358566
DPH  (((((Q9AQD3_PSESY/113-172:0.21720,Q9RCH7_AZOVI/113-171:0.37282):0.20574,MUCA_PSEAE/113-170:0.21151):1.51526,(Q9KPA7_VIBCH/142-208:0.20718,Q52554_PHOPR/154-206:0.68256):0.00000):0.49795,RSEA_ECOLI/131-197:0.98540):0.15527,RSEA_HAEIN/130-195:0.20297,Q9CK46_PASMU/130-195:0.23754);
DTP  (((((Q9AQD3_PSESY/113-172,Q9RCH7_AZOVI/113-171),MUCA_PSEAE/113-170),(Q9KPA7_VIBCH/142-208,Q52554_PHOPR/154-206)),RSEA_ECOLI/131-197),RSEA_HAEIN/130-195,Q9CK46_PASMU/130-195);
DTL  5.4914
RID  0.233579
RPH  (Q9KPA7_VIBCH/142-208:0.16883,(RSEA_ECOLI/131-197:1.49356,(RSEA_HAEIN/130-195:0.06408,Q9CK46_PASMU/130-195:0.45888):0.40665):0.56629,(((Q9RCH7_AZOVI/113-171:0.42239,Q9AQD3_PSESY/113-172:0.46152):0.08351,MUCA_PSEAE/113-170:0.50006):2.26909,Q52554_PHOPR/154-206:0.00000):0.86597);
RTP  (Q9KPA7_VIBCH/142-208,(RSEA_ECOLI/131-197,(RSEA_HAEIN/130-195,Q9CK46_PASMU/130-195)),(((Q9RCH7_AZOVI/113-171,Q9AQD3_PSESY/113-172),MUCA_PSEAE/113-170),Q52554_PHOPR/154-206));
RTL  7.76083
LNK  MUCA_PSEAE/113-170:P38107:L14760
LNK  Q52554_PHOPR/154-206:Q52554:L41667
LNK  Q9AQD3_PSESY/113-172:Q9AQD3:AF190580
LNK  Q9CK46_PASMU/130-195:Q9CK46:AE006215
LNK  Q9KPA7_VIBCH/142-208:Q9KPA7:AE004316
LNK  Q9RCH7_AZOVI/113-171:Q9RCH7:U22660
LNK  RSEA_ECOLI/131-197:P38106:U10148
LNK  RSEA_HAEIN/130-195:P44791:U32745
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CK46_PASMU/130-195
ASQ  VDAPILQTLPFNNVVQQVSYNAPIKDVVTPEQ-LEQKNKRIGAMLQNYEVQRRLYADSLILNQQNTQ
DSQ  GTTGATGCGCCAATTTTACAAACCTTACCGTTTAATAATGTCGTACAGCAAGTAAGTTATAATGCACCGATTAAAGATGTAGTCACACCAGAGCAA---TTGGAACAAAAAAATAAACGCATTGGTGCAATGTTACAAAACTATGAAGTACAACGTCGTCTTTATGCTGACTCTTTAATCTTAAATCAGCAAAACACACAA
TRN  11011101111011010
NAM  RSEA_HAEIN/130-195
ASQ  PETPVLQTLPFNNAVQEVSYNAPSKDTLTSDQ-LEKKSRRIGAMLQNYELQRRMHSDALDVSSSQVR
DSQ  CCTGAGACTCCAGTATTGCAAACCTTGCCATTTAATAATGCGGTTCAAGAGGTTAGCTATAATGCGCCAAGTAAAGATACATTAACTTCAGATCAG---CTTGAGAAAAAAAGTCGTCGCATTGGTGCAATGTTGCAAAATTATGAATTGCAACGTCGAATGCACTCTGATGCTTTAGATGTAAGTAGCAGTCAAGTAAGA
TRN  10010101110011000
NAM  Q52554_PHOPR/154-206
ASQ  SQLPVLQTIPFGGKAEPVSLTRDSVRTGAHNSAPSEAQ--------------LMEQRRRINAMLQDY
DSQ  TCACAATTACCAGTACTTCAAACCATTCCGTTTGGAGGAAAAGCTGAACCTGTCAGCTTAACGCGTGATTCTGTCCGTACTGGTGCGCACAATAGTGCACCAAGTGAAGCGCAA------------------------------------------TTAATGGAGCAACGTCGTCGTATTAACGCGATGCTGCAAGATTAT
TRN  11011101101011000
NAM  Q9KPA7_VIBCH/142-208
ASQ  NELPVLQTIPLAGSAEPVSLTRDSVEKHAPDSSMQEQRRRVNALLQDYELQLRLNSENSASHQHPVE
DSQ  AATGAACTGCCTGTGCTGCAAACCATTCCTCTTGCTGGAAGCGCTGAGCCAGTGAGTTTGACTCGTGATTCGGTGGAAAAGCATGCGCCAGACAGCAGCATGCAAGAGCAACGTCGCCGCGTAAACGCCTTGCTGCAGGACTACGAACTGCAATTACGCCTAAACAGTGAGAATAGTGCTTCTCACCAACACCCAGTTGAA
TRN  11011111101111110
NAM  RSEA_ECOLI/131-197
ASQ  PETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQ
DSQ  CCCGAAACGCCGGTATTTAATACACTGCCGATGATGGGTAAAGCCAGCCCGGTAAGCCTGGGAGTACCTTCTGAAGCGACCGCAAACAATGGTCAACAGCAGCAGGTACAGGAGCAGCGTCGTCGCATTAATGCAATGTTGCAGGATTACGAACTGCAACGCCGACTCCACTCTGAACAGCTTCAGTTTGAGCAGGCGCAA
TRN  11011101101011011
NAM  Q9AQD3_PSESY/113-172
ASQ  AQLAQQTQQP-------ANLTVPQVKGPAVLAGYTESAEQAPGPMANGVLQGGGQGDQRLPGYLRQH
DSQ  GCGCAACTGGCACAGCAGACCCAACAGCCT---------------------GCAAACCTGACTGTTCCGCAAGTGAAAGGCCCGGCCGTACTGGCTGGCTACACTGAAAGCGCCGAGCAAGCGCCTGGTCCTATGGCCAATGGTGTATTGCAGGGCGGTGGTCAAGGTGACCAGCGTCTGCCGGGCTATCTGCGTCAGCAT
TRN  11011101101011011
NAM  MUCA_PSEAE/113-170
ASQ  PQMAQQGTTP--------QIALPQVKGPAVLAGYSEEQGAPQV-ITNSSSSDTRWHEQRLPIYLRQH
DSQ  CCGCAAATGGCGCAACAGGGGACCACCCCG------------------------CAGATCGCCCTGCCTCAGGTGAAAGGCCCGGCCGTGCTGGCCGGCTACAGCGAAGAGCAGGGGGCGCCGCAGGTG---ATCACCAACTCCTCGTCCAGCGATACCCGCTGGCATGAGCAGCGTCTGCCGATCTACCTGCGTCAGCAC
TRN  11011101101011011
NAM  Q9RCH7_AZOVI/113-171
ASQ  AELAQRAPQP--------SLSAPQVQGTPILAGYTEGVEQSQEPSSKDMGKDSEWHEKRLPTYLRQH
DSQ  GCCGAACTGGCTCAGAGGGCACCGCAACCT------------------------TCCCTGTCGGCACCGCAGGTGCAGGGCACCCCGATTCTGGCGGGCTACACCGAGGGCGTCGAGCAATCCCAGGAGCCTTCTTCCAAGGACATGGGGAAGGATTCGGAATGGCATGAAAAAAGGCTTCCCACCTATCTTCGTCAACAT
TRN  10010101100011011
//