EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03866 - HAP)
FAM  PF03866
PID  HAP
DES  Hydrophobic abundant protein (HAP)
IPR  IPR005566
ANO  2
ALN  166
AID  0.496815
APH  (HAPP_PHYPO/1-164:0.67547,HAPS_PHYPO/1-163:0.23078);
ATP  (HAPP_PHYPO/1-164,HAPS_PHYPO/1-163);
ATL  0.90625
DNO  2
DLN  498
DID  0.503106
DPH  (HAPP_PHYPO/1-164:0.84733,HAPS_PHYPO/1-163:0.03464);
DTP  (HAPP_PHYPO/1-164,HAPS_PHYPO/1-163);
DTL  0.88197
RID  0.496815
RPH  (HAPP_PHYPO/1-164:0.78489,HAPS_PHYPO/1-163:0.12136);
RTP  (HAPP_PHYPO/1-164,HAPS_PHYPO/1-163);
RTL  0.90625
LNK  HAPP_PHYPO/1-164:P14163:M22242
LNK  HAPS_PHYPO/1-163:P12671:M22243
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  HAPP_PHYPO/1-164
ASQ  MMKYVFVALCLFAVVALATEVEQKESNTRVARLNVGG--LVGCVVALVANIVGGLLRVIIGLVVTLSGVLQIVVGTVLGLVATVASLALDVVGSTVGGILNSLLGLGAILSLVEEVLHVLLSQALLTGLVNAIFALPLSLLVALSTLTDALASAACDCGASATGAG
DSQ  ATGATGAAATACGTTTTTGTCGCTCTCTGCCTTTTCGCTGTCGTAGCTCTTGCAACTGAGGTAGAACAAAAGGAAAGCAACACCCGTGTCGCCAGACTCAATGTTGGTGGC------CTCGTTGGCTGTGTCGTCGCACTTGTTGCTAACATCGTTGGAGGGCTACTTAGAGTTATCATTGGTCTCGTTGTCACCCTCTCTGGAGTTCTCCAAATTGTCGTCGGTACTGTGCTTGGTCTTGTTGCAACCGTTGCGAGTCTCGCTCTCGATGTCGTTGGTTCAACTGTTGGTGGAATCTTGAACAGCCTCCTCGGCCTCGGTGCTATCCTCAGCCTCGTTGAAGAAGTCTTGCACGTTCTCCTCTCCCAGGCCCTCCTTACTGGTCTCGTCAACGCCATCTTCGCCCTTCCTCTTTCTTTGCTCGTTGCGTTATCCACCCTCACTGATGCCCTCGCTTCTGCCGCTTGCGATTGCGGTGCCAGTGCCACTGGCGCAGGT
TRN  10010101110011000
NAM  HAPS_PHYPO/1-163
ASQ  MMKYIFIALC-FTAIVLASESDVAKA-SEKGLTVRGGDMLLDCIVAVLAQIVSGLLRVIIGLVITLSGVLEIVIGVVVLLVDVLAALALDLVKGSVTGICSDFLDFDYVTEYIEESLRSS-SAQLLAGLVQALLALPLAVLVALVALTESIARSSCSIGLSECGLL
DSQ  ATGATGAAATATATCTTCATTGCGCTCTGC---TTCACTGCCATCGTCCTTGCGTCCGAATCCGATGTGGCCAAAGCT---TCCGAGAAGGGTCTTACAGTAAGAGGAGGAGATATGCTCCTTGATTGCATCGTAGCCGTCCTAGCTCAAATTGTGAGTGGCCTGCTCCGTGTCATTATTGGTCTGGTTATCACTCTTTCCGGAGTTTTGGAGATTGTTATTGGAGTCGTGGTATTGCTCGTGGATGTTTTGGCTGCACTTGCCCTCGACCTCGTGAAAGGCTCAGTGACTGGCATCTGCTCTGACTTCTTGGATTTCGACTACGTTACCGAATACATCGAGGAGTCCCTCAGGTCCTCT---TCTGCACAACTTCTCGCCGGTCTTGTGCAGGCCCTCCTTGCCCTTCCTCTTGCCGTCCTTGTGGCTCTTGTCGCTTTGACTGAATCTATTGCTCGCTCATCGTGCAGCATTGGGCTCTCTGAATGTGGACTCCTC
TRN  10010101100011001
//