EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03862 - SpoVA)
FAM  PF03862
PID  SpoVA
DES  SpoVA protein
IPR  IPR005562
ANO  2
ALN  128
AID  0.327434
APH  (SP55_BACSU/1-119:1.24378,SP53_BACSU/23-150:0.30949);
ATP  (SP55_BACSU/1-119,SP53_BACSU/23-150);
ATL  1.55328
DNO  2
DLN  384
DID  0.439776
DPH  (SP55_BACSU/1-119:0.96561,SP53_BACSU/23-150:0.15285);
DTP  (SP55_BACSU/1-119,SP53_BACSU/23-150);
DTL  1.11846
RID  0.327434
RPH  (SP55_BACSU/1-119:1.39052,SP53_BACSU/23-150:0.16275);
RTP  (SP55_BACSU/1-119,SP53_BACSU/23-150);
RTL  1.55327
LNK  SP53_BACSU/23-150:P40868:D84432
LNK  SP55_BACSU/1-119:P40870:D84432
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SP55_BACSU/1-119
ASQ  MDYLLAFVCGGAICIVGQ----LLLDIFKLTP----AHVMTSFVVIGAILDGFGIYDKFIEFAGGGAIVPIVSFGHSLLHGAMHQAHIHGFIGIGMGIFELTSAGISAAILFAFIVAVI-FKAERISA
DSQ  ATGGACTACCTTTTGGCTTTTGTCTGCGGCGGGGCCATCTGTATCGTCGGCCAG------------CTGCTCTTGGATATTTTTAAATTGACGCCA------------GCTCATGTCATGACATCATTTGTTGTAATCGGTGCAATATTAGATGGTTTCGGCATTTACGATAAATTTATTGAATTTGCCGGAGGAGGCGCCATTGTTCCGATCGTCAGCTTCGGTCACAGTCTTCTGCACGGCGCCATGCATCAGGCGCATATACACGGATTTATCGGAATCGGCATGGGGATTTTTGAGCTGACCTCGGCCGGTATCTCAGCCGCTATTCTTTTCGCCTTTATCGTAGCTGTTATT---TTCAAAGCCGAAAGGATAAGTGCC
TRN  10010101100011000
NAM  SP53_BACSU/23-150
ASQ  WNCVKAFLVGGLICAIGQGLQNFYIHFFDFNEKTAGNPTAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAALEYKSEGLVLGVATNMFKLAGNVIVFGVVAAYIVGMIRFAFEKLMS
DSQ  TGGAACTGTGTAAAAGCCTTTTTAGTGGGCGGACTGATTTGTGCAATCGGGCAAGGTCTGCAAAATTTTTATATCCATTTTTTTGATTTCAATGAAAAAACTGCGGGGAATCCAACAGCTGCAACGCTGATATTAATTTCTGCCCTGCTTACAGGGTTTGGAATCTATGACAGAATCGGACAATTCGCAGGCGCAGGTTCAGCCGTACCTGTCACGGGTTTTGCCAACAGTATGGCAAGTGCGGCTCTTGAATATAAAAGCGAAGGATTAGTGCTTGGAGTAGCGACAAATATGTTTAAACTGGCAGGAAATGTTATTGTTTTCGGAGTTGTAGCTGCATACATCGTTGGAATGATTCGGTTTGCTTTTGAGAAACTGATGTCA
TRN  10010101100011000
//