EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03852 - Vsr)
FAM  PF03852
PID  Vsr
DES  DNA mismatch endonuclease Vsr
IPR  IPR004603
ANO  7
ALN  84
AID  0.416293
APH  (VSX2_XANOR/2-76:0.34189,(Q9A2E1_CAUCR/2-76:0.15297,VSR_ECOLI/1-75:0.88226):0.28150,(VSR_NEIMA/2-76:0.40531,(VSN1_NOCAE/17-97:0.51353,(VSN1_NEIMC/1-75:0.04919,VSH2_HAEPA/1-76:0.20466):0.46609):0.24677):0.32319);
ATP  (VSX2_XANOR/2-76,(Q9A2E1_CAUCR/2-76,VSR_ECOLI/1-75),(VSR_NEIMA/2-76,(VSN1_NOCAE/17-97,(VSN1_NEIMC/1-75,VSH2_HAEPA/1-76))));
ATL  3.86736
DNO  7
DLN  252
DID  0.46442
DPH  ((VSX2_XANOR/2-76:0.38160,(((VSH2_HAEPA/1-76:0.26445,VSN1_NEIMC/1-75:0.12584):0.37822,VSR_NEIMA/2-76:0.32740):0.20382,VSN1_NOCAE/17-97:0.42052):0.18501):0.18192,Q9A2E1_CAUCR/2-76:0.16653,VSR_ECOLI/1-75:0.67465);
DTP  ((VSX2_XANOR/2-76,(((VSH2_HAEPA/1-76,VSN1_NEIMC/1-75),VSR_NEIMA/2-76),VSN1_NOCAE/17-97)),Q9A2E1_CAUCR/2-76,VSR_ECOLI/1-75);
DTL  3.30996
RID  0.416293
RPH  (VSX2_XANOR/2-76:0.34189,(Q9A2E1_CAUCR/2-76:0.15297,VSR_ECOLI/1-75:0.88226):0.28150,(VSR_NEIMA/2-76:0.40531,(VSN1_NOCAE/17-97:0.51353,(VSN1_NEIMC/1-75:0.04919,VSH2_HAEPA/1-76:0.20466):0.46609):0.24677):0.32319);
RTP  (VSX2_XANOR/2-76,(Q9A2E1_CAUCR/2-76,VSR_ECOLI/1-75),(VSR_NEIMA/2-76,(VSN1_NOCAE/17-97,(VSN1_NEIMC/1-75,VSH2_HAEPA/1-76))));
RTL  3.86736
LNK  Q9A2E1_CAUCR/2-76:Q9A2E1:AE006021
LNK  VSH2_HAEPA/1-76:P36434:L17342
LNK  VSN1_NEIMC/1-75:Q9RLM5:AJ238948
LNK  VSN1_NOCAE/17-97:P50186:U09581
LNK  VSR_ECOLI/1-75:P09184:X13330
LNK  VSR_NEIMA/2-76:Q9JWD6:AL162753
LNK  VSX2_XANOR/2-76:Q56829:U06424
AMK  xxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VSR_ECOLI/1-75
ASQ  ADVHDK---ATRSKNMR.AIATRDTAIEKRLASLLTGQGLAFRVQDASLPG-----RPDFVVDEYRCVIFTHGCFWHHHHCYLF
DSQ  GCCGACGTTCACGATAAG---------GCCACTCGCAGCAAAAATATGCGC...GCGATTGCCACGCGTGATACGGCGATAGAGAAGCGCCTCGCCAGTCTGTTAACCGGGCAGGGCCTGGCATTTCGCGTTCAGGACGCCAGTCTGCCCGGA---------------CGTCCGGATTTTGTCGTTGATGAATATCGCTGCGTGATATTTACCCATGGCTGCTTCTGGCATCATCATCACTGCTATCTGTTT
TRN  10010101100011010
NAM  VSX2_XANOR/2-76
ASQ  TDRLSP---ERRRYLMQ.QVRSKNTRPEKAVRSLLHSIAYRFRLHRKDLPG-----TPDIVFPSRRLVLFVHGCFWHGHGCRIG
DSQ  ACTGACCGATTGTCCCCC---------GAGCGTCGTCGCTATCTGATGCAG...CAGGTAAGAAGTAAGAACACGCGGCCCGAGAAGGCGGTGCGCTCTCTACTGCATAGCATTGCGTACCGCTTCCGACTGCACCGCAAAGACTTGCCTGGA---------------ACTCCCGATATCGTGTTTCCGAGCCGGCGCTTAGTGTTGTTCGTGCATGGCTGCTTCTGGCACGGTCATGGGTGTCGGATCGGA
TRN  10010101100011010
NAM  Q9A2E1_CAUCR/2-76
ASQ  SDVYDK---AKRSAVMA.RVRSQDTGPELRLRRLLTGLGARYRLHRKDLPG-----SPDVVMPGRRLAFFVHGCFWHGHDCARG
DSQ  TCCGACGTCTATGACAAG---------GCCAAGCGCTCGGCCGTCATGGCG...CGCGTGCGAAGCCAGGACACCGGTCCTGAGCTTCGCCTGCGCCGGCTGCTTACGGGGCTGGGCGCCCGCTATCGCCTGCACCGCAAGGACCTGCCGGGT---------------TCGCCGGACGTGGTCATGCCGGGGCGGAGGCTGGCCTTCTTCGTCCACGGCTGCTTCTGGCACGGTCACGACTGCGCCCGGGGC
TRN  10010101100011011
NAM  VSH2_HAEPA/1-76
ASQ  MDKLTP---EQRKKCMKaSSKNKGTKPELLLAKYLWALGLRYRKNDRSIFG-----TPDLSFKRYKIAIFIDGEFWHGKDWDIR
DSQ  ATGGATAAATTAACTCCT---------GAGCAACGTAAAAAATGTATGAAAgctAGTAGTAAGAATAAAGGGACAAAGCCTGAGTTACTACTAGCTAAATATTTATGGGCTTTAGGATTAAGATATCGTAAGAATGATAGAAGCATTTTTGGT---------------ACTCCCGATTTAAGTTTTAAAAGGTACAAAATTGCAATTTTTATTGATGGTGAGTTTTGGCATGGAAAGGATTGGGATATTCGA
TRN  10010101110011010
NAM  VSN1_NEIMC/1-75
ASQ  MDRLTP---EQRKKCMQ.SNKSKGTKPELALAKAMWALGLRYRKNSGSIFG-----KPDFSFKKYKVAVFVDGEFWHGKDWEQR
DSQ  ATGGACAGATTAACCCCC---------GAACAGCGCAAAAAATGTATGCAG...TCCAACAAAAGCAAGGGGACGAAGCCCGAGCTTGCGTTGGCGAAGGCGATGTGGGCTTTGGGGCTCAGGTATCGGAAAAATAGCGGAAGCATTTTTGGG---------------AAGCCTGATTTTTCATTTAAAAAATATAAAGTTGCCGTGTTTGTTGATGGCGAGTTTTGGCACGGCAAGGATTGGGAACAGAGA
TRN  10010101110011000
NAM  VSN1_NOCAE/17-97
ASQ  SGTYPAPLNAGRSRNMQ.ANRRSGTKPEAALRSALFKLGYRYRKDFLLRLGDGVKVKPDIVFTARKVAVFIDGCFWH--VCPDH
DSQ  AGCGGTACCTACCCAGCGCCGCTGAACGCTGGGCGCTCGCGGAACATGCAG...GCGAACCGGCGCAGTGGTACGAAACCCGAGGCTGCACTGCGAAGCGCGCTCTTCAAGCTCGGGTACAGGTATCGCAAGGATTTCCTGCTGCGCCTTGGCGACGGCGTCAAGGTCAAACCCGACATCGTCTTCACCGCCCGGAAGGTCGCTGTCTTCATCGACGGCTGCTTCTGGCAT------GTGTGCCCAGACCAC
TRN  10010101100011011
NAM  VSR_NEIMA/2-76
ASQ  TDIFTT---SKRSFVML.KIHSKETKPEVLVRKFLFFQGFRYRKNDKRYVG-----KPDIVLSKYKTVVFIHGCFWYGHSCNKG
DSQ  ACCGATATTTTCACTACA---------TCCAAACGTTCTTTCGTGATGTTA...AAAATCCATAGCAAAGAAACCAAACCGGAAGTATTGGTAAGGAAATTTCTTTTTTTCCAAGGTTTCCGTTATCGGAAAAACGATAAACGCTATGTAGGC---------------AAACCGGATATCGTTTTGTCGAAATATAAAACAGTCGTGTTTATACACGGCTGTTTTTGGTACGGGCATTCTTGTAATAAAGGA
TRN  10010101110011010
//