EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03850 - Tfb4)
FAM  PF03850
PID  Tfb4
DES  Transcription factor Tfb4
IPR  IPR004600
ANO  6
ALN  293
AID  0.308035
APH  (((TF2H3_HUMAN/7-286:0.37332,Q9VPX4_DROME/14-276:0.49092):0.22913,Q09645_CAEEL/49-325:1.25860):0.14294,(O74366_SCHPO/22-283:0.46791,Q12004_YEAST/22-309:0.61567):0.16880,Q9LPQ2_ARATH/12-257:1.28076);
ATP  (((TF2H3_HUMAN/7-286,Q9VPX4_DROME/14-276),Q09645_CAEEL/49-325),(O74366_SCHPO/22-283,Q12004_YEAST/22-309),Q9LPQ2_ARATH/12-257);
ATL  5.02805
DNO  6
DLN  879
DID  0.42166
DPH  (((TF2H3_HUMAN/7-286:0.30425,Q9VPX4_DROME/14-276:0.46610):0.23168,(O74366_SCHPO/22-283:0.36270,Q12004_YEAST/22-309:0.49066):0.11869):0.14186,Q09645_CAEEL/49-325:0.77289,Q9LPQ2_ARATH/12-257:0.62311);
DTP  (((TF2H3_HUMAN/7-286,Q9VPX4_DROME/14-276),(O74366_SCHPO/22-283,Q12004_YEAST/22-309)),Q09645_CAEEL/49-325,Q9LPQ2_ARATH/12-257);
DTL  3.51194
RID  0.308035
RPH  (((TF2H3_HUMAN/7-286:0.37332,Q9VPX4_DROME/14-276:0.49092):0.22913,Q09645_CAEEL/49-325:1.25860):0.14294,(O74366_SCHPO/22-283:0.46791,Q12004_YEAST/22-309:0.61567):0.16880,Q9LPQ2_ARATH/12-257:1.28076);
RTP  (((TF2H3_HUMAN/7-286,Q9VPX4_DROME/14-276),Q09645_CAEEL/49-325),(O74366_SCHPO/22-283,Q12004_YEAST/22-309),Q9LPQ2_ARATH/12-257);
RTL  5.02805
LNK  O74366_SCHPO/22-283:O74366:AL031262
LNK  Q09645_CAEEL/49-325:Q09645:Z47357
LNK  Q12004_YEAST/22-309:Q12004:Z71255
LNK  Q9LPQ2_ARATH/12-257:Q9LPQ2:AC013354
LNK  Q9VPX4_DROME/14-276:Q9VPX4:AE003587
LNK  TF2H3_HUMAN/7-286:Q13889:AF548661
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9LPQ2_ARATH/12-257
ASQ  DVSLLVLLLDTNPLFWSTTSITFSQFLSHVSVSNESIVLAFLNAVLGLNQLNQVVVIATGYSSCDYIYDS---..----SLTSNHGNFES--NGTGMPAIFGSLLKKLEEFVTKDEELSKEEVSED--RIPSCLLWPGTVCFFLHFFSTC----KILSCLSGLIK----RFCHSFRYVAVMNSIFSAQR---------------LMRTQYSMAANSGLFCFAQKT---------IFATDLHSRGFVQLPKPIGVDFRASCFCHKKTIDMGYICSVCLSIFCEHHK--KCSTCG
DSQ  GATGTTAGTCTTCTAGTTTTGTTGCTTGATACGAATCCTCTTTTCTGGAGCACTACATCGATTACCTTCTCTCAGTTCCTTTCTCATGTAAGTGTCTCTAACGAATCTATTGTGCTTGCGTTTCTTAATGCGGTTTTGGGGTTAAATCAGTTGAACCAAGTTGTAGTTATAGCTACTGGATACAGTTCTTGTGATTACATTTATGATTCG---------......------------TCTTTGACATCAAATCATGGAAATTTCGAGAGC------AATGGAACTGGAATGCCTGCAATTTTTGGTTCTTTGCTTAAGAAATTGGAAGAGTTTGTTACCAAAGATGAGGAGCTCAGCAAGGAGGAAGTGTCTGAGGAT------AGAATACCTTCTTGTCTCTTATGGCCCGGAACAGTATGTTTCTTCCTTCATTTTTTTTCTACTTGC------------AAGATTTTGTCTTGTTTGTCTGGTCTCATTAAA------------AGGTTTTGTCATTCTTTCAGGTATGTTGCTGTTATGAACTCTATCTTCTCTGCCCAACGC---------------------------------------------TTGATGCGAACTCAATACTCAATGGCTGCTAACTCTGGATTGTTTTGTTTTGCACAAAAGACA---------------------------ATCTTTGCAACCGATTTGCACTCCCGCGGTTTTGTACAACTTCCTAAACCCATAGGTGTAGATTTTCGCGCATCGTGCTTTTGCCACAAGAAGACAATAGATATGGGCTACATATGCTCAGTGTGTCTGTCCATTTTCTGTGAGCATCACAAG------AAATGTTCAACCTGCGGG
TRN  10010101100011000
NAM  TF2H3_HUMAN/7-286
ASQ  ELNLLVIVVDANPIWWGKQALKESQF---TLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGrlGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHT--ETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKA----AEDSALQYMNFMNVIFAAQKQNILIDACVLDSD--SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP--ICTTCE
DSQ  GAATTGAATCTTCTGGTTATTGTAGTTGATGCCAACCCAATTTGGTGGGGAAAGCAAGCATTAAAGGAATCTCAGTTC---------ACTTTATCCAAATGCATAGATGCCGTGATGGTGCTGGGAAATTCGCATTTATTCATGAATCGTTCCAACAAACTTGCTGTGATAGCAAGTCACATTCAAGAAAGCCGATTCTTATATCCTGGAAAGAATGGCagacttGGAGACTTCTTCGGAGACCCTGGCAACCCTCCTGAATTTAATCCCTCTGGGAGTAAAGATGGAAAATACGAACTTTTAACCTCAGCAAATGAAGTTATTGTTGAAGAGATTAAAGATCTAATGACCAAAAGTGACATAAAGGGTCAACATACA------GAAACTTTGCTGGCAGGATCCCTGGCCAAAGCCCTTTGCTACATTCATAGAATGAACAAGGAAGTTAAAGACAATCAGGAAATGAAATCAAGGATATTGGTGATTAAGGCT------------GCAGAAGACAGTGCGTTGCAGTATATGAACTTCATGAATGTCATCTTTGCAGCACAGAAACAGAATATTTTGATTGATGCCTGTGTTTTAGACTCCGAC------TCAGGGCTCCTCCAACAGGCTTGTGACATCACGGGAGGACTGTACCTGAAGGTGCCTCAGATGCCTTCTCTTCTGCAGTATTTGCTGTGGGTGTTTCTTCCCGATCAAGATCAGAGATCTCAGTTAATCCTCCCACCCCCAGTTCATGTTGACTACAGGGCTGCTTGCTTCTGTCATCGAAATCTCATTGAAATTGGTTATGTCTGTTCTGTGTGTTTGTCAATATTCTGCAATTTCAGCCCC------ATTTGTACTACGTGCGAG
TRN  10010101100011000
NAM  Q9VPX4_DROME/14-276
ASQ  CIDLLVIVLDTNP---SQHFVRQNPQ---NLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHATNFLYPL---..------PRRQVELRQ---VDGQYEAFNLVEKTVKQQLGSILMNAPRLSAPC--ESLLAGSMSMALCYISRLQRNLAPGVKMHSRILVVTG----SNECASQYMTFMNVFFTAQKLGITIDTCALDKT--LSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRELIDIGYVCSVCLSVFCKYSP--ICTTCH
DSQ  TGCATCGACCTCTTGGTGATCGTCCTGGACACGAACCCC---------TCCCAGCACTTCGTGCGCCAGAACCCACAG---------AACCTCACGCAAATCCTGGAGGCGGTGATTGCCTTTGGGAATGCTCACCTGATGCAGAAGGCCCAGAACAAACTGGCTGTGGTATCCTGCTCCCACCATGCCACAAACTTCCTGTATCCGCTG---------......------------------CCCAGAAGACAAGTGGAACTGCGCCAA---------GTGGATGGGCAGTACGAGGCGTTTAATCTGGTGGAGAAGACGGTGAAGCAGCAGCTGGGCAGCATCCTGATGAACGCACCACGGCTCAGCGCTCCTTGT------GAGAGTCTCCTGGCCGGCAGCATGTCCATGGCGCTGTGCTACATATCAAGGCTCCAGAGGAATCTGGCTCCTGGCGTCAAGATGCATTCCCGCATCCTGGTCGTCACAGGC------------AGCAACGAGTGCGCCTCGCAGTACATGACGTTCATGAACGTCTTCTTCACCGCCCAGAAACTGGGCATCACGATCGATACCTGCGCCCTGGACAAGACC------CTCAGTTTGCTACAGCAAGGCTGTGACATTACCTCCGGACAGTTCCTCAAGGTCACCCAGCTGGACGGCCTGCTGCAGTACCTCCTGTGGGTCTTCCTGCCCGCCCCGCAGATCCGTCACAAATTGGTCCTGCCGCCACCGCCCAAAGTGGACTACCGCGCCTCCTGCTTCTGCCATCGTGAGCTGATCGACATTGGCTACGTCTGCTCGGTTTGCCTCTCGGTCTTCTGCAAATACAGTCCC------ATATGCACCACTTGCCAC
TRN  10010101100011001
NAM  O74366_SCHPO/22-283
ASQ  TPSLLVVILDANP---ASWYSLSKKV---PVSKVLADITVFLNAHLAFHHDNRVAVLASHSDKVEYLYPS---..---IAPEQKVAEVDPT-KEANTYRKFREVDDLVLSGMKRLMSSTDKVSR----KTMISGALSRALAYINQVQNKN----TLRSRILIFSL----TGDVALQYIPTMNCIFCAQKKNIPINVCNIEGG--TLFLEQAADATGGIYLKVDNPKGLLQYLMMSLFPDQNLRKHLNTPNQANVDFRATCFCHKKVLDIGFVCSVCLSIFCEPRV--HCSTCH
DSQ  ACACCCAGTTTGCTTGTAGTTATATTAGACGCAAATCCT---------GCCTCATGGTACTCCCTTTCCAAAAAAGTG---------CCTGTTTCCAAGGTACTGGCAGATATTACGGTTTTTCTAAACGCACACTTAGCTTTTCATCATGATAATAGAGTTGCTGTGTTAGCTTCACACTCGGACAAGGTTGAATACCTATACCCTTCG---------......---------ATTGCACCTGAGCAAAAAGTCGCAGAAGTAGATCCTACC---AAGGAGGCAAATACGTATCGAAAGTTTCGTGAGGTAGACGACTTAGTTTTATCTGGGATGAAGCGACTCATGAGTTCGACTGATAAAGTTTCAAGA------------AAAACGATGATTTCCGGAGCACTATCTAGAGCCCTTGCATATATCAATCAAGTTCAAAATAAAAAT------------ACTCTTCGTTCTCGAATTCTAATTTTCTCATTA------------ACTGGTGATGTTGCTCTTCAGTATATTCCTACTATGAATTGTATATTTTGTGCTCAAAAGAAAAATATTCCAATTAACGTTTGCAACATTGAGGGAGGC------ACCCTGTTTTTAGAACAAGCAGCAGATGCCACAGGAGGGATTTACTTAAAAGTTGACAACCCCAAAGGCTTACTACAATATCTCATGATGTCGCTTTTTCCGGATCAAAATCTTCGAAAACACTTAAATACCCCAAACCAAGCGAATGTTGATTTTCGAGCTACATGTTTTTGCCACAAAAAGGTTTTGGATATTGGCTTTGTTTGCTCAGTTTGTCTATCAATATTTTGTGAACCACGGGTG------CATTGTTCTACTTGTCAT
TRN  10010101100011000
NAM  Q12004_YEAST/22-309
ASQ  SPSLLTVIIEIAPKLWTTFDEEGNEKG--SIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPESTS..ALKASESENKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKES-VTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACD
DSQ  TCACCATCTTTGCTTACCGTTATTATAGAAATTGCACCAAAGTTATGGACAACTTTTGATGAGGAAGGAAATGAGAAAGGA------AGTATAATAAAGGTTTTAGAGGCATTGATAGTATTTCTCAATGCTCACTTAGCGTTCAATAGCGCCAACAAAGTAGCAGTCATTGCTGCATACTCTCAGGGAATCAAATATTTATACCCAGAGAGCACATCT......GCTCTAAAAGCCTCTGAATCTGAAAATAAAACCCGTAGTGATCTTAAGATTATTAACTCAGATATGTATAGACGTTTTAGAAACGTTGATGAGACGCTAGTGGAAGAAATATATAAACTATTTGAGTTAGAAAAGAAACAAATCGAACAAAATAGTCAAAGGAGCACGCTAGCAGGTGCCATGTCAGCTGGGCTGACTTATGTAAACAGAATATCAAAAGAGTCA---GTAACTACCTCATTAAAATCAAGGCTACTTGTTCTTACGTGCGGGAGTGGCAGTAGTAAAGATGAAATTTTCCAATACATCCCTATAATGAACTGTATTTTTTCCGCAACAAAAATGAAATGTCCCATTGATGTCGTAAAGATTGGTGGTTCTAAGGAAAGCACGTTTTTACAGCAAACGACGGATGCCACAAATGGCGTTTATTTACATGTTGAATCTACAGAAGGGCTAATTCAATATTTAGCAACTGCAATGTTTATTGATCCGTCGTTAAGACCTATAATTGTTAAGCCAAACCATGGATCTGTAGATTTTAGGACATCATGCTATTTAACAGGGAGAGTTGTTGCCGTTGGATTCATCTGTTCAGTTTGCCTATGTGTCTTATCAATCATACCGCCCGGAAATAAATGTCCTGCTTGTGAT
TRN  10010101100011000
NAM  Q09645_CAEEL/49-325
ASQ  NMSTLSVLIETSSCSWGMLASAHGDR---TIGIILRAIVSFCNAHLGQSANNQLLVFAYGRNVDNKMIYSS--..--TRCEDRNASFLVVKRLRELLSSDALTNDATIGAPLGPALAHAFCHMKKDS-RVVTADPCDDSLGPQTTSEQSETASEKATNRAVVISI----TPIMGSEHGSLMNLFFSAAKQSICVDVVSMGDDFTGGILQQAADITGGSFLHAKKPQTLLKILMTNMLTDPTHRAVFSKLSHNSVDYRASCACHHQLVSSGWVCSICLSVLCQYTP--ICKVCK
DSQ  AATATGAGCACACTATCGGTCTTAATCGAAACATCATCTTGCTCATGGGGAATGCTAGCAAGTGCACACGGTGATCGA---------ACAATTGGAATTATTCTACGAGCAATCGTATCATTCTGCAATGCTCATCTAGGACAATCTGCAAATAATCAGCTTCTAGTTTTTGCATACGGACGAAATGTGGATAACAAAATGATATATTCTTCT------......------ACAAGATGTGAAGATCGGAATGCTTCGTTTCTTGTTGTGAAGCGTTTGCGGGAACTATTGAGTAGTGATGCATTAACTAATGATGCAACTATTGGAGCACCTCTAGGACCTGCCTTGGCTCATGCTTTTTGCCATATGAAAAAAGACAGC---CGAGTAGTAACTGCTGATCCATGTGATGATTCTCTTGGACCTCAGACTACATCAGAACAATCGGAAACCGCATCTGAAAAGGCTACGAATAGAGCAGTAGTGATATCAATT------------ACTCCTATCATGGGAAGCGAACACGGATCGTTAATGAATTTGTTCTTCTCTGCTGCAAAACAGTCAATCTGCGTTGATGTTGTATCGATGGGAGATGATTTTACTGGTGGAATCCTTCAACAGGCAGCAGATATTACTGGCGGATCTTTTCTACATGCCAAAAAACCACAGACTTTATTGAAAATTTTAATGACTAATATGCTAACCGATCCAACTCACCGTGCAGTATTCTCGAAGCTTTCTCATAATTCAGTCGATTATCGAGCATCCTGTGCGTGTCATCATCAGCTTGTATCCTCCGGTTGGGTGTGCTCCATCTGTCTTTCAGTCCTCTGCCAATATACTCCA------ATATGCAAAGTTTGCAAA
TRN  10010101110011000
//