EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03846 - SulA)
FAM  PF03846
PID  SulA
DES  Cell division inhibitor SulA
IPR  IPR004596
ANO  4
ALN  119
AID  0.671478
APH  ((SULA_ENTAE/2-120:0.19262,SULA_SERMA/3-120:0.60593):0.06568,SULA_ECOLI/2-120:0.11677,SULA_SALTY/2-120:0.10886);
ATP  ((SULA_ENTAE/2-120,SULA_SERMA/3-120),SULA_ECOLI/2-120,SULA_SALTY/2-120);
ATL  1.08986
DNO  4
DLN  357
DID  0.646675
DPH  ((SULA_ENTAE/2-120:4.95707,SULA_SERMA/3-120:26.39615):3.58114,SULA_ECOLI/2-120:4.58793,SULA_SALTY/2-120:5.56088);
DTP  ((SULA_ENTAE/2-120,SULA_SERMA/3-120),SULA_ECOLI/2-120,SULA_SALTY/2-120);
DTL  44.7757
RID  0.671478
RPH  ((SULA_ENTAE/2-120:0.19262,SULA_SERMA/3-120:0.60593):0.06568,SULA_ECOLI/2-120:0.11677,SULA_SALTY/2-120:0.10886);
RTP  ((SULA_ENTAE/2-120,SULA_SERMA/3-120),SULA_ECOLI/2-120,SULA_SALTY/2-120);
RTL  1.08986
LNK  SULA_ECOLI/2-120:P08846:U00096
LNK  SULA_ENTAE/2-120:P08848:M16467
LNK  SULA_SALTY/2-120:P08847:AE008746
LNK  SULA_SERMA/3-120:P08845:M16468
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SULA_SERMA/3-120
ASQ  TQSLYQPHFGHGSYTTRNVAKNTDIGKENGLISELVYNERQPAVAQ-LLLPLLLQLGKQSRWLLWLTPQQKLSKQWLQQSGLPVDKMVQLSQISPVNTVEAMEKALQTGNYSVVLGWLP
DSQ  ACTCAATCACTCTACCAACCTCATTTCGGCCATGGCTCTTATACAACGCGCAATGTTGCGAAGAACACGGATATCGGCAAAGAGAATGGCTTGATCAGTGAACTTGTTTACAACGAGCGCCAGCCCGCAGTGGCTCAA---TTACTGTTGCCCCTGCTGCTGCAATTGGGCAAGCAGTCTCGCTGGCTTCTGTGGCTGACGCCGCAGCAAAAATTAAGCAAGCAATGGCTGCAGCAATCCGGCCTGCCTGTCGATAAAATGGTGCAATTGAGCCAAATCAGCCCGGTGAATACGGTTGAGGCGATGGAAAAAGCGCTGCAAACGGGAAATTACAGCGTGGTTCTCGGCTGGTTGCCC
TRN  11011101101011000
NAM  SULA_ENTAE/2-120
ASQ  FTSAHANRSPLTSASVRRPSHSVVEHSATGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSKEWVQSSGLPLSKVMQINQMSPCNTLESMIRALRTGNYNVVIGWLT
DSQ  TTTACTTCAGCTCACGCAAATCGTTCACCACTGACTTCGGCTTCAGTACGTCGCCCTTCGCACAGCGTCGTCGAACATTCAGCCACTGGGCTGATTAGTGAAATCGTCTATCGCGAAGATCAACCCATGATGACGCAGCTTTTGCTGCTACCTTTATTACAGCAGCTTGGCCAGCAGTCGCGCTGGCAACTGTGGCTCACCCCGCAGCAAAAGCTGAGTAAAGAATGGGTACAGTCGTCCGGCCTTCCGCTTTCAAAAGTGATGCAGATTAACCAGATGTCGCCCTGCAATACTTTGGAATCGATGATTCGCGCTTTACGTACCGGGAATTATAACGTGGTTATTGGCTGGCTGACG
TRN  11011101101011000
NAM  SULA_ECOLI/2-120
ASQ  YTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLA
DSQ  TACACTTCAGGCTATGCACATCGTTCTTCGTCGTTCTCATCCGCAGCAAGTAAAATTGCGCGTGTCTCTACGGAAAACACTACAGCCGGGCTTATCAGTGAAGTTGTCTATCGCGAAGATCAGCCCATGATGACGCAACTTCTACTGTTGCCATTGTTACAGCAACTCGGTCAGCAATCGCGCTGGCAACTCTGGTTAACACCGCAACAAAAACTGAGTCGGGAATGGGTTCAGGCATCTGGGCTACCCTTAACGAAAGTAATGCAGATTAGCCAGCTCTCCCCTTGCCACACTGTGGAGTCAATGGTTCGCGCTTTACGCACGGGCAATTACAGTGTGGTGATCGGTTGGTTGGCA
TRN  11011101101011000
NAM  SULA_SALTY/2-120
ASQ  YTSGYANRSSSFPTTTHNAARTATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRQLGQQSRWQLWLTPQQKLSREWVQSSGLPLTKVMQISQLAPRHTLESMIRALRTGNYSVVIGWMT
DSQ  TACACTTCAGGTTATGCAAATCGTTCTTCGTCATTTCCTACCACTACCCACAACGCTGCGCGCACCGCTACGGAAAATGCCGCGGCAGGACTGGTCAGTGAAGTTGTCTACCACGAAGACCAGCCCATGATGGCGCAACTCCTGCTTTTGCCTTTACTCCGTCAGTTAGGCCAACAATCACGATGGCAGCTCTGGCTCACGCCGCAGCAAAAGCTCAGCCGTGAATGGGTACAGTCTTCAGGTTTGCCATTAACGAAAGTGATGCAAATTAGCCAGCTTGCGCCTCGTCATACGCTGGAGTCGATGATCCGCGCTTTGCGTACAGGAAATTACAGCGTGGTAATTGGTTGGATGACT
TRN  11011101101011000
//